Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15518 45 / 4e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032656 [exp] 48 / 5e-08 AT3G15518 65 / 1e-14 unknown protein Lus10043096 [exp] 45 / 4e-07 AT3G15518 61 / 2e-13 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G123600 [exp] 42 / 7e-06 AT3G15518 64 / 2e-14 unknown protein Potri.001G404500 [exp] 40 / 5e-05 AT3G15518 66 / 2e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037893 pacid=23163725 polypeptide=Lus10037893 locus=Lus10037893.g ID=Lus10037893.BGIv1.0 annot-version=v1.0 ATGAGCGGTATCAACATTGTGCAAAGACGCTACAGCTCGCCGGCGGCGGAGGGCGGCGGAAGAAGTAGCGGCGGCGTTTCATCTAATTCGCCAAGGGTGA TAAAGGCATCCCCGCCATCCAGGTGCGGAGCGGCGCGTCACCGTTACGCCATTCCGGCATCGCGCAGTCATGAGAAGTTGATGAGGAGGCAGGGAAGTAG AGAGATTTTATTGAGGAGGGCTTTGGTGCCGTCCAGTAAGAGGCCCAGTCTCCGGTGGTTGAATTTCCGGCCAACTCCCAGTCGCCTCTCTAGCATGTCG TCCATGGCAACCTCTGGATTTTAA
AA sequence Show only first row Show all	>Lus10037893 pacid=23163725 polypeptide=Lus10037893 locus=Lus10037893.g ID=Lus10037893.BGIv1.0 annot-version=v1.0 MSGINIVQRRYSSPAAEGGGRSSGGVSSNSPRVIKASPPSRCGAARHRYAIPASRSHEKLMRRQGSREILLRRALVPSSKRPSLRWLNFRPTPSRLSSMS SMATSGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15518			unknown protein		Lus10037893 [exp]	0	1
AT1G29290			unknown protein		Lus10029256 [exp]	1.4	0.9109
AT1G75800			Pathogenesis-related thaumatin...		Lus10017265 [exp]	7.2	0.7983
AT3G11820		PEN1, AT-SYR1, ...	PENETRATION1, SYNTAXIN RELATED...		Lus10021263 [exp]	7.6	0.8339
AT1G34300			lectin protein kinase family p...		Lus10013252 [exp]	9.2	0.8331
AT5G35735			Auxin-responsive family protei...		Lus10012350 [exp]	10.4	0.8332
AT1G21326			VQ motif-containing protein (....		Lus10042794 [exp]	12.3	0.7904
AT1G74950	ZIM	TIFY10B, JAZ2	JASMONATE-ZIM-DOMAIN PROTEIN 2...		Lus10013166 [exp]	13.4	0.8295
AT1G76650		CML38	calmodulin-like 38 (.1.2.3)		Lus10022343 [exp]	14.3	0.8331
AT5G13200			GRAM domain family protein (.1...		Lus10035154 [exp]	14.5	0.7978
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Lus10034897 [exp]	15.2	0.8116

Compare expression of checked genes

Lus10037893 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.