Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029768 [exp] 72 / 1e-16 AT1G21326 79 / 4e-18 VQ motif-containing protein (.1) Lus10018905 [exp] 44 / 8e-07 ND / Lus10028604 [exp] 0 / 1 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G070600 [exp] 51 / 1e-08 AT1G21326 76 / 3e-16 VQ motif-containing protein (.1) Potri.005G189300 [exp] 51 / 1e-08 AT1G21326 75 / 4e-16 VQ motif-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037918 pacid=23163666 polypeptide=Lus10037918 locus=Lus10037918.g ID=Lus10037918.BGIv1.0 annot-version=v1.0 ATGACTCTAGTTCAGCGCCTCACCGGATCGTCCACCTCCGCCGCAGAGGATTCGTCCAAGAACCCGTTTCCTGACTCGGGAGCGATGTCGCCGGCTGCGA TGTACACGTCGATTGAGAAGACGAGGTCGCCGAAGGAGAAGGCGGGTAGTAGTAATTATAATCAGAATCAAATGGGTAATGGCGATTTGGGGGATTCCTT CATGGAAGGAGTGGAGATGGGTGAGAAAGATTGCCGCCAGGGATATTGTCTCCCGGTCCTGGTTAGTTGCCGCCGATTTGTCCAAGCTTCTTCTGTCCGC CGATTGCTCGCCCCAACTCTCTATCAGAATCTCTAA
AA sequence Show only first row Show all	>Lus10037918 pacid=23163666 polypeptide=Lus10037918 locus=Lus10037918.g ID=Lus10037918.BGIv1.0 annot-version=v1.0 MTLVQRLTGSSTSAAEDSSKNPFPDSGAMSPAAMYTSIEKTRSPKEKAGSSNYNQNQMGNGDLGDSFMEGVEMGEKDCRQGYCLPVLVSCRRFVQASSVR RLLAPTLYQNL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10037918 [exp]	0	1
AT1G13810			Restriction endonuclease, type...		Lus10012108 [exp]	10.5	0.7402
AT2G03380			Pentatricopeptide repeat (PPR)...		Lus10026641 [exp]	17.8	0.7309
AT3G57440			unknown protein		Lus10042062 [exp]	26.0	0.7284
AT4G32090			Beta-1,3-N-Acetylglucosaminylt...		Lus10012177 [exp]	28.3	0.7240
AT3G05950			RmlC-like cupins superfamily p...		Lus10015128 [exp]	34.4	0.7145
					Lus10039897 [exp]	34.6	0.7168
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10030261 [exp]	36.3	0.7198
AT4G23470			PLAC8 family protein (.1.2.3)		Lus10005117 [exp]	38.1	0.6689
AT5G47240		ATNUDT8	nudix hydrolase homolog 8 (.1)		Lus10004371 [exp]	38.7	0.7116
					Lus10034724 [exp]	40.0	0.7036

Compare expression of checked genes

Lus10037918 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.