Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14890 128 / 2e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 117 / 5e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G23205 113 / 2e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G70720 106 / 4e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 83 / 7e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62360 81 / 4e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 80 / 8e-19 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 79 / 2e-18 PME1 pectin methylesterase inhibitor 1 (.1) AT5G62350 78 / 7e-18 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 74 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038645 [exp] 185 / 2e-59 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 81 / 5e-19 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 81 / 8e-19 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031711 [exp] 79 / 3e-18 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 79 / 3e-18 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 76 / 3e-17 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027199 [exp] 75 / 7e-17 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10024596 [exp] 74 / 8e-17 AT5G62360 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031712 [exp] 72 / 9e-16 AT5G51520 149 / 2e-45 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G109300 [exp] 152 / 7e-47 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G132600 [exp] 147 / 8e-45 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 83 / 6e-20 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 82 / 1e-19 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.014G129400 [exp] 81 / 4e-19 AT3G62820 163 / 6e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 79 / 1e-18 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128700 [exp] 79 / 3e-18 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 77 / 8e-18 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 76 / 2e-17 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 75 / 5e-17 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10037919 pacid=23163857 polypeptide=Lus10037919 locus=Lus10037919.g ID=Lus10037919.BGIv1.0 annot-version=v1.0 ATGATAACCAATCCGCTAACTCCACCGCCGACTATATCCGGTCCAGCTGCAACGCCACGCTGTACCCTGACGTCTGCTACACCTCCCTCTCCCGCTACGC CAGCGCCGTCCAGCAGAGCCCCTCCCGCCTCGCCGTCGTGGCTGGGGGGGCCGGCCTATCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNACGGCTCCGACCGCCGCGGCGCCTCGGCACTCCACGACTGCCTCTCAAGCTTCGGCGACGCCATCGACGAGATCCGCAGC TCCCTGAAGCAGATGCGGGAGCTCGGGGAATCGGCCGGATCTTCTTCGGCGGAGGAGTTCCGGTTCCAGATGAGCAACGTGCAGACGTGGATGAGTGCGG CGCTTACCGACGAGGAGACGTGTACGGACGGGTTCGAGGAGATCGGTGACGGGGAAGTGAAGGAGGCGATTTGCAAGCGTGCGGAGGTGGCCAAGAAGTT CACGAGTAATGCGCTTGCCTTGGTTAACAGTTACGCTGCCGCCGGAATCCCCTAG
AA sequence Show only first row Show all	>Lus10037919 pacid=23163857 polypeptide=Lus10037919 locus=Lus10037919.g ID=Lus10037919.BGIv1.0 annot-version=v1.0 MITNPLTPPPTISGPAATPRCTLTSATPPSPATPAPSSRAPPASPSWLGGPAYXXXXXXXXXXXXXXXXXXXXXGSDRRGASALHDCLSSFGDAIDEIRS SLKQMRELGESAGSSSAEEFRFQMSNVQTWMSAALTDEETCTDGFEEIGDGEVKEAICKRAEVAKKFTSNALALVNSYAAAGIP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14890			Plant invertase/pectin methyle...		Lus10037919 [exp]	0	1
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10014234 [exp]	5.1	0.9280
AT2G46890			Protein of unknown function (D...		Lus10009861 [exp]	6.0	0.9207
AT3G17390		MAT4, SAMS3, MT...	S-ADENOSYLMETHIONINE SYNTHETAS...		Lus10004522 [exp]	6.8	0.9244
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10005504 [exp]	7.5	0.9155
AT5G03300		ADK2	adenosine kinase 2 (.1)		Lus10023532 [exp]	9.5	0.9176
AT4G01850		AtSAM2, SAM-2, ...	S-adenosylmethionine synthetas...		Lus10010070 [exp]	9.5	0.9195
AT1G06780		GAUT6	galacturonosyltransferase 6 (....		Lus10024859 [exp]	12.2	0.9199
AT5G38450		CYP735A1	"cytochrome P450, family 735, ...		Lus10017595 [exp]	13.7	0.9146
AT3G06035			Glycoprotein membrane precurso...		Lus10034054 [exp]	14.0	0.9085
AT1G04360			RING/U-box superfamily protein...		Lus10021197 [exp]	14.8	0.9129

Compare expression of checked genes

Lus10037919 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.