Lus10037930 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038662 221 / 6e-76 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10037930 pacid=23163806 polypeptide=Lus10037930 locus=Lus10037930.g ID=Lus10037930.BGIv1.0 annot-version=v1.0
ATGGAGAGCAAGATGAGAGGATTTGTTGTGTTGATTGCAGTAGCTGCAACAATGTTGATGCTGTTTGCTGGGCAATGCCAGTCAGCTCCTTCTGCTGATG
CTAAGAGTAGTCGTAAAGGCCACAAGATGAACCTCGGTGTATGCAACCCACTCTGCTTCTACCAATGTGCTGTCAACAAAGGCGACATGTTTTGCTATGG
CAAGTGCCTAATGGAGTGCGCCGCAGTCTTTAATGGGAAACCTGACCCCAATAATCCCCGAGACATCTGCTTCATCAGCTGTGCTGTCCCTGGCTGTGCT
AGCCTCTGCACCAAAGAGCACCCTTTCCCCGTGGAAAAGGTACAGACTTGTCTGCAGACTTGCTCAGACAACTGTGACGACATCAAGCCTGATAATTAA
AA sequence
>Lus10037930 pacid=23163806 polypeptide=Lus10037930 locus=Lus10037930.g ID=Lus10037930.BGIv1.0 annot-version=v1.0
MESKMRGFVVLIAVAATMLMLFAGQCQSAPSADAKSSRKGHKMNLGVCNPLCFYQCAVNKGDMFCYGKCLMECAAVFNGKPDPNNPRDICFISCAVPGCA
SLCTKEHPFPVEKVQTCLQTCSDNCDDIKPDN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10037930 0 1
AT5G60900 RLK1 receptor-like protein kinase 1... Lus10024195 4.4 0.8539
AT5G16080 ATCXE17 carboxyesterase 17 (.1) Lus10033548 5.5 0.8119
AT2G36400 GRF ATGRF3 growth-regulating factor 3 (.1... Lus10028899 6.9 0.7745
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10040243 7.5 0.7655
AT4G01950 ATGPAT3, GPAT3 glycerol-3-phosphate acyltrans... Lus10001449 7.9 0.8285
AT3G55700 UDP-Glycosyltransferase superf... Lus10040244 13.3 0.7293
AT2G33530 SCPL46 serine carboxypeptidase-like 4... Lus10040327 19.4 0.7944
AT5G06900 CYP93D1 "cytochrome P450, family 93, s... Lus10027796 22.6 0.7631
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10040245 22.6 0.7896
Lus10001030 23.2 0.7426

Lus10037930 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.