Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46560 163 / 3e-54 TIM9, EMB2474 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) AT2G29530 39 / 4e-05 TIM10 Tim10/DDP family zinc finger protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038695 [exp] 195 / 8e-67 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10017463 [exp] 172 / 2e-57 AT3G46560 156 / 2e-51 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10028819 [exp] 112 / 2e-34 AT3G46560 110 / 1e-33 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10016453 [exp] 36 / 0.0005 AT2G29530 145 / 2e-47 Tim10/DDP family zinc finger protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G039100 [exp] 161 / 3e-53 AT3G46560 154 / 1e-50 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Potri.009G039600 [exp] 36 / 0.0004 AT2G29530 141 / 1e-45 Tim10/DDP family zinc finger protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [flax] [poplar] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Lus10037964 pacid=23163844 polypeptide=Lus10037964 locus=Lus10037964.g ID=Lus10037964.BGIv1.0 annot-version=v1.0 ATGGACAAGAACATGCTCGCCGGCCTGGAAGGTATGCCTGAAGAAGACAAGCTGAGAATGGCCTCCATGATCGACCAGCTCCAAATCCGCGACAGTTTGA GGATGTACAATTCTCTTGTGGAGAGGTGCTTTACGGATTGCGTGGACGACTTCAGCCGCAAGTCTCTGAAGAAGCAAGAGGAGACTTGTGTTCAGAGATG CGCAGAGAAGTTCTTGAAGCATTCTATGCGCGTTGGGATGAGGTTTGCGGAGCTCAACCAAGGAGCAGCTACTCCTGATAACTAA
AA sequence Show only first row Show all	>Lus10037964 pacid=23163844 polypeptide=Lus10037964 locus=Lus10037964.g ID=Lus10037964.BGIv1.0 annot-version=v1.0 MDKNMLAGLEGMPEEDKLRMASMIDQLQIRDSLRMYNSLVERCFTDCVDDFSRKSLKKQEETCVQRCAEKFLKHSMRVGMRFAELNQGAATPDN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46560		TIM9, EMB2474	embryo defective 2474, Tim10/D...		Lus10037964 [exp]	0	1
AT3G11510			Ribosomal protein S11 family p...		Lus10022693 [exp]	5.3	0.9394
AT3G16780			Ribosomal protein L19e family ...		Lus10038417 [exp]	6.7	0.9294
AT3G53740			Ribosomal protein L36e family ...		Lus10016466 [exp]	9.5	0.9180
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10023454 [exp]	11.1	0.9362
AT1G13690		ATE1	ATPase E1 (.1)		Lus10004641 [exp]	12.7	0.9242
AT1G22780		RPS18A, PFL1, P...	40S RIBOSOMAL PROTEIN S18, POI...		Lus10042603 [exp]	13.8	0.9275
AT1G63980			D111/G-patch domain-containing...		Lus10032300 [exp]	15.1	0.8704
AT4G18100			Ribosomal protein L32e (.1)		Lus10009591 [exp]	15.5	0.9285
AT3G16780			Ribosomal protein L19e family ...		Lus10016829 [exp]	16.6	0.9229
AT5G24510			60S acidic ribosomal protein f...		Lus10028876 [exp]	17.7	0.9223

Compare expression of checked genes

Lus10037964 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.