Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04260 149 / 3e-47 WCRKC2 WCRKC thioredoxin 2 (.1) AT5G06690 118 / 8e-35 WCRKC1 WCRKC thioredoxin 1 (.1.2) AT3G15360 49 / 4e-08 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT1G19730 45 / 4e-07 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT2G35010 45 / 6e-07 ATO1 thioredoxin O1 (.1.2) AT1G03680 45 / 1e-06 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT4G03520 44 / 4e-06 ATHM2 Thioredoxin superfamily protein (.1.2) AT3G53220 42 / 1e-05 Thioredoxin superfamily protein (.1) AT5G42980 40 / 3e-05 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G11530 40 / 3e-05 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038703 [exp] 182 / 2e-59 AT5G04260 191 / 2e-61 WCRKC thioredoxin 2 (.1) Lus10021067 [exp] 120 / 9e-36 AT5G06690 215 / 3e-71 WCRKC thioredoxin 1 (.1.2) Lus10017244 [exp] 73 / 2e-17 AT5G06690 156 / 2e-48 WCRKC thioredoxin 1 (.1.2) Lus10007630 [exp] 47 / 2e-07 AT1G11530 143 / 4e-45 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10018383 [exp] 47 / 2e-07 AT1G11530 145 / 3e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10041799 [exp] 45 / 4e-07 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 45 / 6e-07 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10013827 [exp] 45 / 6e-07 AT3G53220 172 / 2e-56 Thioredoxin superfamily protein (.1) Lus10042784 [exp] 45 / 1e-06 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G225701 [exp] 154 / 6e-49 AT5G04260 204 / 3e-67 WCRKC thioredoxin 2 (.1) Potri.008G036400 [exp] 149 / 7e-47 AT5G04260 216 / 8e-72 WCRKC thioredoxin 2 (.1) Potri.016G059500 [exp] 128 / 6e-39 AT5G06690 212 / 4e-70 WCRKC thioredoxin 1 (.1.2) Potri.005G186800 [exp] 49 / 3e-08 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.013G132200 [exp] 48 / 7e-08 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.001G401500 [exp] 47 / 1e-07 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.002G073000 [exp] 47 / 1e-07 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.019G111200 [exp] 46 / 4e-07 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.005G058400 [exp] 45 / 8e-07 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.017G076700 [exp] 44 / 2e-06 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10037975 pacid=23163668 polypeptide=Lus10037975 locus=Lus10037975.g ID=Lus10037975.BGIv1.0 annot-version=v1.0 ATGTCAGAGCCTAATAGCGTTGTTTACTCTTCCAGGATGGCCAATTGGTGCAGAAAATGTATATATTTGAAACCAAAGCTGGAAAGATTAGCAGCTGACT ATCATCCCAGTCTGAGATTCTACTGCGTAGACGTCAACAACGTGCCTCACAAGCTAGTAGCTCGAGCAGGAGTCACTAAAATGCCAACAATACAGCTGTG GAGAGATGGGGAGAAGCAAGGAGAAGTAATTGGCGGGCACAAGGCTTACCAGGTGATCAATGAAGTTAGACAAATGATTGAGACTAGTAGTATCGAGGGT GGTGACATCTGA
AA sequence Show only first row Show all	>Lus10037975 pacid=23163668 polypeptide=Lus10037975 locus=Lus10037975.g ID=Lus10037975.BGIv1.0 annot-version=v1.0 MSEPNSVVYSSRMANWCRKCIYLKPKLERLAADYHPSLRFYCVDVNNVPHKLVARAGVTKMPTIQLWRDGEKQGEVIGGHKAYQVINEVRQMIETSSIEG GDI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G04260		WCRKC2	WCRKC thioredoxin 2 (.1)		Lus10037975 [exp]	0	1
AT3G09010			Protein kinase superfamily pro...		Lus10040392 [exp]	9.9	0.8820
AT4G12790			P-loop containing nucleoside t...		Lus10041086 [exp]	10.4	0.8844
AT3G29170			Eukaryotic protein of unknown ...		Lus10028939 [exp]	14.1	0.8694
AT4G16100			Protein of unknown function (D...		Lus10037717 [exp]	15.2	0.8714
					Lus10009514 [exp]	17.7	0.8606
AT1G08230		ATGAT1	L-GAMMA-AMINOBUTYRIC ACID TRAN...		Lus10009386 [exp]	18.8	0.8598
AT3G61710		AtBECLIN1, ATAT...	BECLIN1, AUTOPHAGY 6 (.1.2.3)		Lus10012632 [exp]	22.0	0.8799
AT5G53390			O-acyltransferase (WSD1-like) ...		Lus10014075 [exp]	23.6	0.8801
AT4G08850			Leucine-rich repeat receptor-l...		Lus10008712 [exp]	28.1	0.8805
AT1G12600			UDP-N-acetylglucosamine (UAA) ...		Lus10029605 [exp]	29.3	0.8722

Compare expression of checked genes

Lus10037975 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.