Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03310 66 / 5e-15 SAUR-like auxin-responsive protein family (.1) AT3G53250 62 / 7e-14 SAUR-like auxin-responsive protein family (.1) AT2G37030 62 / 2e-13 SAUR-like auxin-responsive protein family (.1) AT3G20220 50 / 3e-09 SAUR-like auxin-responsive protein family (.1) AT1G75590 51 / 4e-09 SAUR-like auxin-responsive protein family (.1) AT4G38825 48 / 1e-08 SAUR-like auxin-responsive protein family (.1) AT4G38840 48 / 1e-08 SAUR-like auxin-responsive protein family (.1) AT3G20210 50 / 2e-08 DELTAVPE, DELTA-VPE delta vacuolar processing enzyme (.1.2) AT4G34800 48 / 2e-08 SAUR-like auxin-responsive protein family (.1) AT4G34810 48 / 2e-08 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009219 [exp] 129 / 3e-40 AT3G53250 70 / 7e-17 SAUR-like auxin-responsive protein family (.1) Lus10026521 [exp] 71 / 7e-17 AT2G37030 139 / 8e-44 SAUR-like auxin-responsive protein family (.1) Lus10013808 [exp] 68 / 4e-16 AT2G37030 141 / 1e-44 SAUR-like auxin-responsive protein family (.1) Lus10008996 [exp] 51 / 2e-09 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10038193 [exp] 51 / 2e-09 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 51 / 2e-09 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 50 / 7e-09 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 48 / 2e-08 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 49 / 3e-08 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G091500 [exp] 64 / 1e-14 AT2G37030 136 / 2e-42 SAUR-like auxin-responsive protein family (.1) Potri.008G037900 [exp] 64 / 2e-14 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.010G224500 [exp] 64 / 2e-14 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.006G126500 [exp] 63 / 6e-14 AT2G37030 131 / 1e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 54 / 7e-11 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 50 / 4e-09 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.004G165450 [exp] 49 / 6e-09 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G165800 [exp] 49 / 6e-09 AT4G34770 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.004G165300 [exp] 49 / 1e-08 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 49 / 1e-08 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10037990 pacid=23163792 polypeptide=Lus10037990 locus=Lus10037990.g ID=Lus10037990.BGIv1.0 annot-version=v1.0 ATGGAAGCTGGAAGAAAGGCGTTGGCCAAGTACTACAGAGGAGGCTGCATCCCCAAGGACGTGCCGAGAGGGCATATGGCGGTGTACGTTGGAGTAGAGG AATGGAAAAGATACGTGATCAAAGTTTGTTTGATTAACCATCCATTGTTCAGGACTCTGCTTGATCAGCTACTTGATTACCAGTCTCAAGATTTCAGGTT ACCTTCAACCCCTCTTCATATTCCTTGCAGCGACTCCATTTTCTTAACCATTTTGAACTGCGCCCAACGGGACTACTTCTCGCCTCGCTTTTGCTTCTGA
AA sequence Show only first row Show all	>Lus10037990 pacid=23163792 polypeptide=Lus10037990 locus=Lus10037990.g ID=Lus10037990.BGIv1.0 annot-version=v1.0 MEAGRKALAKYYRGGCIPKDVPRGHMAVYVGVEEWKRYVIKVCLINHPLFRTLLDQLLDYQSQDFRLPSTPLHIPCSDSIFLTILNCAQRDYFSPRFCF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03310			SAUR-like auxin-responsive pro...		Lus10037990 [exp]	0	1
AT5G46490			Disease resistance protein (TI...		Lus10042465 [exp]	1.4	0.8510
					Lus10032744 [exp]	2.0	0.8313
AT1G67090		RBCS1A	ribulose bisphosphate carboxyl...		Lus10034357 [exp]	3.7	0.8234
AT1G63740			Disease resistance protein (TI...		Lus10010546 [exp]	6.7	0.8230
AT3G07870			F-box and associated interacti...		Lus10012357 [exp]	12.0	0.8069
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Lus10024049 [exp]	14.5	0.8186
AT1G76510	ARID		ARID/BRIGHT DNA-binding domain...		Lus10026569 [exp]	16.2	0.7971
AT5G45820		PKS18, CIPK20, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10007283 [exp]	21.9	0.7789
AT3G52440	DOF	AtDof3,5	Dof-type zinc finger DNA-bindi...		Lus10021266 [exp]	23.1	0.8351
AT3G50610			unknown protein		Lus10009346 [exp]	28.8	0.8160

Compare expression of checked genes

Lus10037990 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.