Lus10037995 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47840 315 / 1e-109 AMK2 adenosine monophosphate kinase (.1)
AT5G35170 232 / 1e-73 adenylate kinase family protein (.1.2)
AT5G63400 122 / 1e-34 ADK1 adenylate kinase 1 (.1.2)
AT5G50370 113 / 5e-31 Adenylate kinase family protein (.1)
AT5G26667 102 / 3e-27 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
AT4G25280 100 / 6e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G37250 94 / 3e-23 ADK, ATPADK1 adenosine kinase (.1)
AT3G60180 90 / 2e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT2G39270 89 / 2e-21 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G01820 51 / 8e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009478 300 / 1e-105 AT5G47840 293 / 1e-101 adenosine monophosphate kinase (.1)
Lus10009228 303 / 2e-105 AT5G47840 296 / 3e-101 adenosine monophosphate kinase (.1)
Lus10003504 291 / 2e-100 AT5G47840 300 / 1e-102 adenosine monophosphate kinase (.1)
Lus10036326 224 / 2e-71 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2)
Lus10019071 182 / 4e-54 AT5G35170 720 / 0.0 adenylate kinase family protein (.1.2)
Lus10016757 122 / 2e-34 AT5G63400 416 / 2e-149 adenylate kinase 1 (.1.2)
Lus10022453 120 / 8e-34 AT5G63400 411 / 2e-147 adenylate kinase 1 (.1.2)
Lus10031611 95 / 3e-24 AT5G26667 343 / 1e-121 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10023476 96 / 8e-24 AT2G37250 407 / 2e-144 adenosine kinase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G103400 332 / 2e-116 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1)
Potri.019G078200 327 / 2e-114 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1)
Potri.018G113400 231 / 5e-73 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2)
Potri.006G189201 125 / 3e-37 AT5G35170 158 / 1e-46 adenylate kinase family protein (.1.2)
Potri.012G095300 119 / 2e-33 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2)
Potri.015G092800 119 / 4e-33 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2)
Potri.002G134600 97 / 5e-25 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.014G043300 97 / 6e-25 AT5G26667 358 / 2e-127 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.015G129000 97 / 7e-25 AT4G25280 301 / 6e-104 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.014G104700 95 / 4e-24 AT5G26667 275 / 8e-95 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00406 ADK Adenylate kinase
Representative CDS sequence
>Lus10037995 pacid=23163797 polypeptide=Lus10037995 locus=Lus10037995.g ID=Lus10037995.BGIv1.0 annot-version=v1.0
ATGGCGGACCCGCCTCTTAGAATCATGATTTCAGGTGCTCCTGCCTCTGGTAAAGGTACCCAGTGTGAGCTCATTACTAAAAAGTACAGCTTGGTGCACA
TTGCAGCTGGAGATCTGCTTCGAGCTGAAATCGCTTTCGGAAGTGAGAATGGTAAGCAGGCAAAAGAATACATGGAGAAAGGTCAGCTGGTCCCAGATGA
AATAGTTGTGATGATGGTGAAGGACCGGTTGATGCAGCCTGACTCGCAAGAAAATGGCTGGCTGTTAGATGGATATCCACGGAGCTCGTCTCAAGCTACT
GCTCTCAAGGGATATGGCTTCGAACCCGATATTTTCATTGTCTTACAAGTCCCTGAAGAGATTCTTGTTGAAAGAGTTGTTGGACGTAGACTGGATCCTG
TTACTGGCAAGATATACCACATGACTTACTCTCCCCCTGAGACTGAAGAAATAGCTGCCAGACTAACCCAACGTTTCGATGATACTGAAGAAAAGGTGAA
AGGGAATGCCCCAAAAGAAGAAGTTTTTGCTGAGATTGACGGCGCACTGACAAAATTGCTCGAGAGTAGGAAGGCAACTTGA
AA sequence
>Lus10037995 pacid=23163797 polypeptide=Lus10037995 locus=Lus10037995.g ID=Lus10037995.BGIv1.0 annot-version=v1.0
MADPPLRIMISGAPASGKGTQCELITKKYSLVHIAAGDLLRAEIAFGSENGKQAKEYMEKGQLVPDEIVVMMVKDRLMQPDSQENGWLLDGYPRSSSQAT
ALKGYGFEPDIFIVLQVPEEILVERVVGRRLDPVTGKIYHMTYSPPETEEIAARLTQRFDDTEEKVKGNAPKEEVFAEIDGALTKLLESRKAT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G47840 AMK2 adenosine monophosphate kinase... Lus10037995 0 1
AT2G36270 bZIP EEL, GIA1, ABI5 GROWTH-INSENSITIVITY TO ABA 1,... Lus10017049 5.2 0.8689
AT5G24170 Got1/Sft2-like vescicle transp... Lus10019023 13.6 0.7901
Lus10022042 21.5 0.8083
AT2G37240 Thioredoxin superfamily protei... Lus10029111 22.1 0.8188
AT2G36270 bZIP EEL, GIA1, ABI5 GROWTH-INSENSITIVITY TO ABA 1,... Lus10021369 24.2 0.8513
AT5G41140 Myosin heavy chain-related pro... Lus10008012 26.0 0.8103
AT1G68910 WIT2 WPP domain-interacting protein... Lus10029109 29.2 0.8022
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10013614 33.9 0.8277
AT5G22370 QQT1, EMB1705 QUATRE-QUART 1, EMBRYO DEFECTI... Lus10007747 45.5 0.8155
AT4G38580 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPREN... Lus10014120 46.7 0.8179

Lus10037995 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.