Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44890 68 / 3e-15 CYP704A1 "cytochrome P450, family 704, subfamily A, polypeptide 1", cytochrome P450, family 704, subfamily A, polypeptide 1 (.1.2) AT2G45510 63 / 2e-13 CYP704A2 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) AT1G69500 45 / 6e-07 CYP704B1 "cytochrome P450, family 704, subfamily B, polypeptide 1", cytochrome P450, family 704, subfamily B, polypeptide 1 (.1) AT1G57750 42 / 4e-06 MAH1, CYP96A15 MID-CHAIN ALKANE HYDROXYLASE 1, "cytochrome P450, family 96, subfamily A, polypeptide 15", cytochrome P450, family 96, subfamily A, polypeptide 15 (.1.2) AT5G08250 41 / 8e-06 Cytochrome P450 superfamily protein (.1) AT2G27690 40 / 2e-05 CYP94C1 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) AT5G23190 38 / 0.0001 CYP86B1 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) AT5G02900 37 / 0.0003 CYP96A13 "cytochrome P450, family 96, subfamily A, polypeptide 13", cytochrome P450, family 96, subfamily A, polypeptide 13 (.1) AT4G39490 36 / 0.0006 CYP96A10 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009232 [exp] 105 / 3e-28 AT2G45510 639 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Lus10015018 [exp] 65 / 4e-14 AT2G45510 586 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Lus10038896 [exp] 62 / 5e-13 AT2G45510 582 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Lus10037999 [exp] 53 / 9e-10 AT2G45510 539 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Lus10036772 [exp] 45 / 7e-07 AT1G69500 863 / 0.0 "cytochrome P450, family 704, subfamily B, polypeptide 1", cytochrome P450, family 704, subfamily B, polypeptide 1 (.1) Lus10037157 [exp] 45 / 7e-07 AT1G69500 868 / 0.0 "cytochrome P450, family 704, subfamily B, polypeptide 1", cytochrome P450, family 704, subfamily B, polypeptide 1 (.1) Lus10040986 [exp] 42 / 5e-06 AT5G23190 751 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10017394 [exp] 39 / 6e-05 AT5G23190 739 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Lus10010193 [exp] 38 / 0.0001 AT5G23190 741 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G072000 [exp] 81 / 1e-19 AT2G45510 706 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Potri.012G131200 [exp] 62 / 3e-13 AT2G44890 511 / 7e-178 "cytochrome P450, family 704, subfamily A, polypeptide 1", cytochrome P450, family 704, subfamily A, polypeptide 1 (.1.2) Potri.014G072100 [exp] 60 / 3e-12 AT2G45510 563 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Potri.014G072300 [exp] 58 / 1e-11 AT2G45510 563 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Potri.008G088900 [exp] 44 / 7e-07 AT1G69500 868 / 0.0 "cytochrome P450, family 704, subfamily B, polypeptide 1", cytochrome P450, family 704, subfamily B, polypeptide 1 (.1) Potri.007G072100 [exp] 41 / 1e-05 AT5G23190 799 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.005G092200 [exp] 40 / 2e-05 AT5G23190 788 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.004G185300 [exp] 40 / 3e-05 AT2G27690 604 / 0.0 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) Potri.009G145400 [exp] 38 / 0.0001 AT2G27690 622 / 0.0 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038000 pacid=23163872 polypeptide=Lus10038000 locus=Lus10038000.g ID=Lus10038000.BGIv1.0 annot-version=v1.0 ATGCTTTACTTCACTAAGCTCTACGACCACCTCACGGAGATCGCCAGAACCCACCGGACTTTCAGGCTGCTAGCTCCGGACTGCAGCAGCCTTTACGCAA CCGACCCGAGGAACGTGGAGCATATTCTCAAGACCGACTTCGGGAAGTACTCGAAAGGGAGAGGTTTTGGTTCTAAGGGTTGTGTTCCGATCCTTTGA
AA sequence Show only first row Show all	>Lus10038000 pacid=23163872 polypeptide=Lus10038000 locus=Lus10038000.g ID=Lus10038000.BGIv1.0 annot-version=v1.0 MLYFTKLYDHLTEIARTHRTFRLLAPDCSSLYATDPRNVEHILKTDFGKYSKGRGFGSKGCVPIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G44890		CYP704A1	"cytochrome P450, family 704, ...		Lus10038000 [exp]	0	1
AT1G12240		ATBETAFRUCT4, V...	VACUOLAR INVERTASE, Glycosyl h...		Lus10024605 [exp]	4.9	0.8276
AT3G29000			Calcium-binding EF-hand family...		Lus10026974 [exp]	9.3	0.8343
AT4G25400	bHLH	bHLH118	basic helix-loop-helix (bHLH) ...		Lus10031675 [exp]	17.4	0.8325
AT1G15780			unknown protein		Lus10015321 [exp]	24.4	0.8313
AT1G52800			2-oxoglutarate (2OG) and Fe(II...		Lus10005775 [exp]	26.7	0.7638
AT1G48320			Thioesterase superfamily prote...		Lus10011142 [exp]	31.4	0.7863
AT3G17180		SCPL33	serine carboxypeptidase-like 3...		Lus10037810 [exp]	32.4	0.8043
AT4G14060			Polyketide cyclase/dehydrase a...		Lus10008932 [exp]	45.5	0.8153
AT4G35160			O-methyltransferase family pro...		Lus10023987 [exp]	48.2	0.8131
AT5G28740			Tetratricopeptide repeat (TPR)...		Lus10003866 [exp]	49.2	0.7295

Compare expression of checked genes

Lus10038000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.