Lus10038012 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
AT5G18380 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
AT3G04230 243 / 5e-84 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009252 306 / 9e-109 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10035133 290 / 1e-102 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10031970 290 / 1e-102 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10034378 288 / 7e-102 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Lus10012599 286 / 4e-101 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G304700 274 / 3e-96 AT2G09990 267 / 9e-94 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.008G150000 273 / 4e-96 AT2G09990 262 / 1e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.010G091000 272 / 1e-95 AT2G09990 260 / 7e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0329 S5 PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Representative CDS sequence
>Lus10038012 pacid=23163720 polypeptide=Lus10038012 locus=Lus10038012.g ID=Lus10038012.BGIv1.0 annot-version=v1.0
ATGGCGGCGCCGGCAGCAACGGGAGCATCTCCGATCGAGTCAGTCCAGTGCTTCGGTCGCAAGAAGACCGCGGTGGCCGTCACCCACTGCAAGAGAGGAA
GAGGCCTGATCAAGCTCAACGGTACACCCATCGAGCTCGTGGAGCCCGAGATACTACGCTTCAAGGCCGTGGAGCCGATCCTTCTCCTCGGCCGTCAGCG
CTTCAGCGGCGTTGACATGAGGATCCGCGTCAAGGGAGGAGGACACACATCCCAAATCTACGCCATCCGTCAGAGCATCGCCAAGGCGCTTGTGGCTTTT
TACCAGAAGTTCGTCGACGAGCAGAGCAAGAAGGAGATCAAGGACCTTCTCATCAGGTACGATAGGACTCTCTTGGTTGCTGATCCCAGGAGGTGCGAGC
CTAAGAAGTTCGGTGGTCGTGGTGCCCGTTCTAGGTTTCAGAAGAGTTACCGTTGA
AA sequence
>Lus10038012 pacid=23163720 polypeptide=Lus10038012 locus=Lus10038012.g ID=Lus10038012.BGIv1.0 annot-version=v1.0
MAAPAATGASPIESVQCFGRKKTAVAVTHCKRGRGLIKLNGTPIELVEPEILRFKAVEPILLLGRQRFSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAF
YQKFVDEQSKKEIKDLLIRYDRTLLVADPRRCEPKKFGGRGARSRFQKSYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G09990 Ribosomal protein S5 domain 2-... Lus10038012 0 1
AT5G27470 seryl-tRNA synthetase / serine... Lus10017409 1.4 0.8794
AT5G46160 Ribosomal protein L14p/L23e fa... Lus10023296 2.8 0.8366
AT5G02960 Ribosomal protein S12/S23 fami... Lus10023172 4.2 0.8609
AT1G16740 Ribosomal protein L20 (.1) Lus10006327 5.5 0.7970
AT1G26880 Ribosomal protein L34e superfa... Lus10036750 8.8 0.8448
AT2G44620 MTACP1, MTACP-1 mitochondrial acyl carrier pro... Lus10043348 9.9 0.8052
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10024560 13.0 0.8201
AT3G02080 Ribosomal protein S19e family ... Lus10020836 13.9 0.8278
AT1G14300 ARM repeat superfamily protein... Lus10037185 14.7 0.8125
AT2G31410 unknown protein Lus10031995 17.5 0.7936

Lus10038012 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.