Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62030 161 / 5e-50 CYP20-3, ROC4 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) AT5G13120 147 / 2e-44 Pnsl5, ATCYP20-2 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) AT2G29960 136 / 7e-41 CYP19-4, ATCYP5, CYP5 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) AT5G58710 136 / 9e-41 ROC7 rotamase CYP 7 (.1) AT4G38740 135 / 1e-40 ROC1 rotamase CYP 1 (.1) AT2G21130 134 / 3e-40 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G56070 129 / 3e-38 ROC2 rotamase cyclophilin 2 (.1.2) AT2G16600 127 / 9e-38 ROC3 rotamase CYP 3 (.1.2) AT4G34870 123 / 6e-36 ATCYP1, ROC5 ARABIDOPSIS THALIANA CYCLOPHILIN 1, rotamase cyclophilin 5 (.1) AT3G55920 121 / 1e-34 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009255 [exp] 333 / 8e-119 AT3G62030 164 / 4e-51 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) Lus10011330 [exp] 152 / 4e-46 AT5G13120 336 / 2e-117 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) Lus10003138 [exp] 150 / 4e-45 AT5G13120 333 / 2e-115 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) Lus10018238 [exp] 136 / 1e-40 AT2G29960 348 / 4e-124 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10040666 [exp] 136 / 1e-40 AT5G58710 347 / 2e-123 rotamase CYP 7 (.1) Lus10038315 [exp] 134 / 1e-39 AT2G29960 313 / 1e-109 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10007579 [exp] 131 / 3e-39 AT2G16600 311 / 2e-110 rotamase CYP 3 (.1.2) Lus10012167 [exp] 131 / 3e-39 AT2G16600 313 / 4e-111 rotamase CYP 3 (.1.2) Lus10017258 [exp] 127 / 1e-37 AT2G16600 308 / 6e-109 rotamase CYP 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G185200 [exp] 178 / 2e-56 AT3G62030 293 / 2e-100 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) Potri.001G060200 [exp] 149 / 6e-45 AT5G13120 297 / 7e-102 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) Potri.003G167700 [exp] 146 / 4e-44 AT5G13120 277 / 5e-94 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) Potri.009G046500 [exp] 134 / 5e-40 AT2G29960 323 / 4e-114 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Potri.010G189000 [exp] 135 / 6e-40 AT3G55920 303 / 4e-105 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.004G168800 [exp] 132 / 2e-39 AT2G16600 278 / 4e-97 rotamase CYP 3 (.1.2) Potri.009G130100 [exp] 131 / 2e-39 AT2G21130 279 / 1e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G251700 [exp] 129 / 5e-38 AT5G58710 313 / 6e-110 rotamase CYP 7 (.1) Potri.002G021500 [exp] 127 / 1e-37 AT2G16600 278 / 2e-97 rotamase CYP 3 (.1.2) Potri.005G240200 [exp] 127 / 1e-37 AT2G16600 276 / 2e-96 rotamase CYP 3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [flax] [poplar] Cyclophil-like PF00160 [flax] [poplar] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Lus10038015 pacid=23163651 polypeptide=Lus10038015 locus=Lus10038015.g ID=Lus10038015.BGIv1.0 annot-version=v1.0 ATGGCGTCCACCACCTTCTCCCTCCAGACCTCTCGCATCCTACTTCCGGGAAGTTGCAGCCAAAGTTGTCGGTTGGGTTGTTCGCCGGCAAATTCGGTTT CATCAAGCCGCATTGGGAAACCATTGACGTCAGAAGCTGGTTTCCCTTTCCTGCGACTCTCTTCGCCATCTTCTATTATTAAGCAGAGGAGGAAGCCGTT TGTTGTTAACTCCGCAGCCAGCGGAACTGGAGGAGTTAGTATCTATGGTGAAAAATTTGAGGATGAGAGCTTTCACTTGAAGCATGTTGGTCCAGGAGTG TTGAGCATGGCTAATGCTGGCCCTGATACCAATGGAAGCCAATTTTTCATTTGCACTGTGAAGACTCCATGGTTGGACAACAGACACGTGGTGTTTGGAA ATGTCATTGATGGAATGGATATTGTACGTAAGCTCGAAGCTGTAGAGACCAGCCGGTCTGATATCCCTCGGATGCCCTGCAGAATTGTTGATTGTGGGGA GCTGCCGTTCGAATAA
AA sequence Show only first row Show all	>Lus10038015 pacid=23163651 polypeptide=Lus10038015 locus=Lus10038015.g ID=Lus10038015.BGIv1.0 annot-version=v1.0 MASTTFSLQTSRILLPGSCSQSCRLGCSPANSVSSSRIGKPLTSEAGFPFLRLSSPSSIIKQRRKPFVVNSAASGTGGVSIYGEKFEDESFHLKHVGPGV LSMANAGPDTNGSQFFICTVKTPWLDNRHVVFGNVIDGMDIVRKLEAVETSRSDIPRMPCRIVDCGELPFE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62030		CYP20-3, ROC4	cyclophilin 20-3, rotamase CYP...		Lus10038015 [exp]	0	1
AT3G12080		EMB2738	embryo defective 2738, GTP-bin...		Lus10027371 [exp]	3.2	0.9377
AT4G12970		EPFL9, STOMAGEN	stomagen (.1)		Lus10009589 [exp]	3.5	0.9176
AT5G23310		FSD3	Fe superoxide dismutase 3 (.1)		Lus10010174 [exp]	6.8	0.9227
AT3G21300			RNA methyltransferase family p...		Lus10009743 [exp]	6.9	0.9021
AT3G21300			RNA methyltransferase family p...		Lus10000172 [exp]	8.1	0.8960
AT1G15390		PDF1A, ATDEF1	peptide deformylase 1A (.1)		Lus10011493 [exp]	9.5	0.8991
AT1G56050			GTP-binding protein-related (....		Lus10031789 [exp]	12.0	0.9193
AT5G64050		ATERS, ERS, OVA...	OVULE ABORTION 3, glutamate tR...		Lus10012512 [exp]	12.6	0.8687
AT1G57750		MAH1, CYP96A15	MID-CHAIN ALKANE HYDROXYLASE 1...		Lus10002523 [exp]	13.1	0.8914
AT3G14110		FLU	FLUORESCENT IN BLUE LIGHT, Tet...		Lus10015677 [exp]	14.8	0.9217

Compare expression of checked genes

Lus10038015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.