Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62100 118 / 3e-34 AUX_IAA IAA30 indole-3-acetic acid inducible 30 (.1) AT2G46990 118 / 4e-34 AUX_IAA IAA20 indole-3-acetic acid inducible 20 (.1) AT3G17600 107 / 8e-30 AUX_IAA IAA31 indole-3-acetic acid inducible 31 (.1) AT2G33310 94 / 1e-23 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT4G28640 90 / 2e-22 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT1G04550 90 / 3e-22 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT5G25890 84 / 1e-20 AUX_IAA IAR2, IAA28 IAA-ALANINE RESISTANT 2, indole-3-acetic acid inducible 28 (.1) AT3G16500 84 / 6e-20 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) AT5G65670 85 / 7e-20 AUX_IAA IAA9 indole-3-acetic acid inducible 9 (.1.2) AT1G51950 82 / 2e-19 AUX_IAA IAA18 indole-3-acetic acid inducible 18 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009967 [exp] 228 / 9e-78 AT3G62100 128 / 2e-38 indole-3-acetic acid inducible 30 (.1) Lus10010081 [exp] 166 / 5e-53 AT2G46990 115 / 4e-33 indole-3-acetic acid inducible 20 (.1) Lus10007193 [exp] 166 / 8e-53 AT3G62100 117 / 4e-34 indole-3-acetic acid inducible 30 (.1) Lus10014464 [exp] 93 / 6e-23 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10023719 [exp] 93 / 7e-23 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10022868 [exp] 89 / 1e-21 AT4G28640 198 / 1e-62 indole-3-acetic acid inducible 11 (.1.2.3) Lus10039413 [exp] 84 / 3e-20 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10039488 [exp] 83 / 3e-20 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10038285 [exp] 84 / 2e-19 AT3G16500 224 / 3e-72 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G111700 [exp] 144 / 3e-44 AT3G62100 150 / 7e-47 indole-3-acetic acid inducible 30 (.1) Potri.002G186400 [exp] 136 / 3e-41 AT3G62100 147 / 3e-45 indole-3-acetic acid inducible 30 (.1) Potri.010G065200 [exp] 91 / 3e-22 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.008G172400 [exp] 91 / 3e-22 AT2G33310 246 / 4e-81 auxin-induced protein 13 (.1.2.3) Potri.013G041300 [exp] 87 / 1e-21 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.006G255200 [exp] 87 / 2e-21 AT4G32280 137 / 7e-40 indole-3-acetic acid inducible 29 (.1) Potri.002G045000 [exp] 84 / 2e-20 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G218200 [exp] 84 / 2e-20 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 83 / 3e-20 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.003G048100 [exp] 86 / 4e-20 AT3G16500 224 / 4e-72 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10038025 pacid=23163681 polypeptide=Lus10038025 locus=Lus10038025.g ID=Lus10038025.BGIv1.0 annot-version=v1.0 ATGGGAAGAGGAGCGGCTAGTAATCATCATTACAACTCTACTTGCCCTTCTTCGTTTTCATCTTCTTCTTCTTCTTCTTCAATGTCTCATCACAAAAGAC ACCGGAGAGACCTCACCACCGATCTCCGGCTCGGCCTCAGCAACAACTCCGGCGGCCGCGATGAAATGGAGTATGGAAACAACAACAACAACAACAACAA CAACCATGGCGGCCGTGGTGGTGCTACTTTCTTTGTGAAGGTGTACATGGAAGGCATCCCAATTGGGAGGAAGTTGGATTTGTTGGCTTATGCTTCTTAT GAAGACATGATCTCCACTCTTGATGCCATGTTTGGCACCAACATTCTTTGGGATGAGATGGAAAGTGACCAGAGCAATTACAATGGACAAGTGCAATACC ATGTGTTGACTTATGAAGACAAAGAAGGAGATTGGTTGATTGTTGGAGATGTTCCATGGGAGGTGTTTGTGTCCTGCGTGAAGAGACTGAAGATAACTAG AGCAGATAGCTTGTGA
AA sequence Show only first row Show all	>Lus10038025 pacid=23163681 polypeptide=Lus10038025 locus=Lus10038025.g ID=Lus10038025.BGIv1.0 annot-version=v1.0 MGRGAASNHHYNSTCPSSFSSSSSSSSMSHHKRHRRDLTTDLRLGLSNNSGGRDEMEYGNNNNNNNNNHGGRGGATFFVKVYMEGIPIGRKLDLLAYASY EDMISTLDAMFGTNILWDEMESDQSNYNGQVQYHVLTYEDKEGDWLIVGDVPWEVFVSCVKRLKITRADSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62100	AUX_IAA	IAA30	indole-3-acetic acid inducible...		Lus10038025 [exp]	0	1
AT4G35200			Arabidopsis protein of unknown...		Lus10003332 [exp]	5.8	0.9001
AT5G62680			Major facilitator superfamily ...		Lus10033106 [exp]	6.2	0.8906
AT4G35200			Arabidopsis protein of unknown...		Lus10022635 [exp]	9.2	0.8826
AT2G30340	AS2	LBD13	LOB domain-containing protein ...		Lus10034208 [exp]	12.0	0.8608
AT2G24280			alpha/beta-Hydrolases superfam...		Lus10017002 [exp]	17.6	0.8750
AT1G70560		CKRC1, WEI8, TA...	WEAK ETHYLENE INSENSITIVE 8, S...		Lus10006199 [exp]	23.3	0.8759
AT1G66350	GRAS	RGL1	RGA-like 1 (.1)		Lus10017930 [exp]	23.6	0.8061
AT4G35200			Arabidopsis protein of unknown...		Lus10023958 [exp]	24.3	0.8673
AT5G19730			Pectin lyase-like superfamily ...		Lus10012942 [exp]	35.2	0.8718
AT3G09270		ATGSTU8	glutathione S-transferase TAU ...		Lus10021103 [exp]	35.7	0.8721

Compare expression of checked genes

Lus10038025 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.