Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15580 199 / 1e-67 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) AT3G06420 174 / 9e-58 ATG8H autophagy 8h, Ubiquitin-like superfamily protein (.1) AT2G05630 142 / 8e-45 ATG8D Ubiquitin-like superfamily protein (.1.2) AT4G21980 140 / 3e-44 ATG8A, APG8A AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) AT1G62040 138 / 2e-43 ATG8C autophagy 8c, Ubiquitin-like superfamily protein (.1.2) AT4G04620 138 / 3e-43 ATG8B autophagy 8b, Ubiquitin-like superfamily protein (.1.2) AT2G45170 134 / 8e-42 ATATG8E AUTOPHAGY 8E (.1.2) AT4G16520 133 / 2e-41 ATG8F autophagy 8f, Ubiquitin-like superfamily protein (.1.2) AT3G60640 132 / 3e-41 ATG8G AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009987 [exp] 230 / 1e-71 AT3G62240 625 / 0.0 RING/U-box superfamily protein (.1) Lus10027186 [exp] 143 / 2e-45 AT2G05630 222 / 1e-76 Ubiquitin-like superfamily protein (.1.2) Lus10015563 [exp] 137 / 6e-43 AT1G62040 230 / 1e-79 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Lus10039656 [exp] 136 / 1e-41 AT2G05630 203 / 6e-68 Ubiquitin-like superfamily protein (.1.2) Lus10000733 [exp] 132 / 6e-41 AT4G16520 217 / 1e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10008507 [exp] 132 / 6e-41 AT4G16520 216 / 3e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10028933 [exp] 129 / 9e-40 AT4G16520 215 / 6e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10004352 [exp] 127 / 8e-39 AT2G45170 203 / 1e-68 AUTOPHAGY 8E (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G189450 [exp] 204 / 1e-69 AT3G15580 194 / 2e-65 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) Potri.010G153400 [exp] 198 / 2e-67 AT3G15580 191 / 3e-64 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) Potri.008G099400 [exp] 193 / 4e-65 AT3G15580 187 / 7e-63 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) Potri.004G013700 [exp] 144 / 5e-46 AT1G62040 216 / 3e-74 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Potri.014G153800 [exp] 141 / 9e-45 AT2G05630 202 / 6e-69 Ubiquitin-like superfamily protein (.1.2) Potri.002G228800 [exp] 141 / 2e-44 AT2G05630 224 / 1e-77 Ubiquitin-like superfamily protein (.1.2) Potri.011G004300 [exp] 139 / 2e-43 AT4G21980 219 / 1e-74 AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) Potri.002G144600 [exp] 136 / 1e-42 AT3G60640 192 / 8e-65 AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) Potri.001G122700 [exp] 135 / 2e-42 AT4G16520 191 / 2e-64 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.008G136040 [exp] 135 / 2e-42 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02991 [flax] [poplar] Atg8 Autophagy protein Atg8 ubiquitin like
Representative CDS sequence Show only first row Show all	>Lus10038046 pacid=23163748 polypeptide=Lus10038046 locus=Lus10038046.g ID=Lus10038046.BGIv1.0 annot-version=v1.0 ATGGCGATCTCCTTCAAAGCTGAATTCACCTTTGAGCAAAGACTCTCGGAATCGCGCGAATTGATCGCCAAGTATCCCGATCGAGTTCCGGTAATTGCTG AAAGATACTGCAAAACTGACCTTCCTCAGATGGAAAAGAAGAAATATCTGGTCCCGAGAGACATGTCAGTCGGACAATTCATTCACATCCTAAGTAACAG GCTTCATATGACCCCGGGGAAAGCTCTCTTCGTGTTCGTCAACAACACCCTACCTCAAACATCCACCGCCATGGACTCAATCTATGAATCCTTCAAAGAT GAAGATGGATTTCTCTACATGTGCTACAGCAGTGAGAAGACCTTTGGCTCTGATTGCCTACACTAG
AA sequence Show only first row Show all	>Lus10038046 pacid=23163748 polypeptide=Lus10038046 locus=Lus10038046.g ID=Lus10038046.BGIv1.0 annot-version=v1.0 MAISFKAEFTFEQRLSESRELIAKYPDRVPVIAERYCKTDLPQMEKKKYLVPRDMSVGQFIHILSNRLHMTPGKALFVFVNNTLPQTSTAMDSIYESFKD EDGFLYMCYSSEKTFGSDCLH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15580		APG8H, ATG8I	AUTOPHAGY 8I, AUTOPHAGY 8H, Ub...		Lus10038046 [exp]	0	1
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10031458 [exp]	1.4	0.8539
AT3G29130			unknown protein		Lus10000252 [exp]	2.0	0.8119
					Lus10040104 [exp]	2.0	0.8466
AT5G64460			Phosphoglycerate mutase family...		Lus10020467 [exp]	2.4	0.8000
AT4G07990			Chaperone DnaJ-domain superfam...		Lus10032795 [exp]	4.0	0.7955
AT2G23090			Uncharacterised protein family...		Lus10019287 [exp]	5.9	0.8116
AT1G14820			Sec14p-like phosphatidylinosit...		Lus10003699 [exp]	7.1	0.8300
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Lus10036939 [exp]	7.3	0.7926
AT5G23090	CCAAT	NF-YB13	"nuclear factor Y, subunit B13...		Lus10009614 [exp]	7.7	0.7863
					Lus10033126 [exp]	9.2	0.7981

Compare expression of checked genes

Lus10038046 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.