Lus10038051 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036784 96 / 7e-25 ND /
Lus10010597 77 / 4e-18 ND /
Lus10010267 50 / 4e-08 ND /
Lus10012295 50 / 2e-07 ND /
Lus10005499 47 / 5e-07 ND /
Lus10034889 46 / 3e-06 AT1G09190 115 / 9e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040010 46 / 3e-06 ND /
Lus10032723 45 / 1e-05 ND /
Lus10038610 43 / 2e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10038051 pacid=23163747 polypeptide=Lus10038051 locus=Lus10038051.g ID=Lus10038051.BGIv1.0 annot-version=v1.0
ATGAGAGAACATGGTGAAGTTGTAGACAATCTGCATATGGTAGATGAACTCAGTCATAATGAGATTCACTATATGGAAGATGATATGGTTAGGCTTGTAC
ATGAAGCTTTTGGACAGCCTATTACAAATGCACATGATCAACCCAATGATGGCGAGGACGGTAATAAGTCCTTAGGAATAGGAGGACTAATCCACCAGTT
GGATGATTCGGATTGGACCACTGATCCTGAATTCTATGAAGCCATGAAGAACTTAGGGATTCTGGGGTTGCGGAGGAAGTACAAAGTTCAGCCCATAGAA
TATGGGGAAGAAGTGGACCAGTTGTATGGCAGGATTCCTCCTCCACAGGACTTGAATGTAGAAGACCTTGGCAGTGGTAATGGTGCCATATCAGAACCCA
TCTGCGACGATGCTGCCATCTGTTCCGACGATGAGAACAATACCCCTGACGTTGAAGATAGCTTGAGCCACTCGAGATCGGATGCAGACTTGGAAAATGA
TGGTCAGGAATGA
AA sequence
>Lus10038051 pacid=23163747 polypeptide=Lus10038051 locus=Lus10038051.g ID=Lus10038051.BGIv1.0 annot-version=v1.0
MREHGEVVDNLHMVDELSHNEIHYMEDDMVRLVHEAFGQPITNAHDQPNDGEDGNKSLGIGGLIHQLDDSDWTTDPEFYEAMKNLGILGLRRKYKVQPIE
YGEEVDQLYGRIPPPQDLNVEDLGSGNGAISEPICDDAAICSDDENNTPDVEDSLSHSRSDADLENDGQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10038051 0 1
Lus10003825 1.7 1.0000
AT3G12750 ZIP1 zinc transporter 1 precursor (... Lus10014062 2.4 1.0000
AT5G56990 unknown protein Lus10029528 3.0 1.0000
AT5G59190 subtilase family protein (.1) Lus10040747 3.2 0.9908
Lus10037868 4.2 0.9633
AT5G01660 unknown protein Lus10040599 4.9 1.0000
AT4G27420 ABCG9 ATP-binding cassette G9, ABC-2... Lus10029635 4.9 1.0000
Lus10029261 5.0 1.0000
AT5G15110 Pectate lyase family protein (... Lus10030791 5.3 0.9980
AT4G27570 UDP-Glycosyltransferase superf... Lus10013367 5.7 0.9945

Lus10038051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.