Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01897 160 / 5e-52 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G191200 [exp] 171 / 3e-56 AT4G01897 166 / 4e-54 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0084 [flax] [poplar] ADP-ribosyl PF06108 [flax] [poplar] DUF952 Protein of unknown function (DUF952)
Representative CDS sequence Show only first row Show all	>Lus10038061 pacid=23163767 polypeptide=Lus10038061 locus=Lus10038061.g ID=Lus10038061.BGIv1.0 annot-version=v1.0 ATGGAAGCAAGCGGCGGCAGCGAGAAAAAGTTGGTGTACAGGATCAGCACAGCCGCGGAATGGGAGCAGTTCCAGAAAGACGGATCCACGTACGGCGGAG AAATCGACACCTCTTCCCGATTCATCCACCTCAGTGACCTGAATCAGGTGATGTCGACTCTCAACAACTTCTTCCGAAATGTCGACACGGATCTGTTCCT CCTCCAAATCGACGCTAAAAAGCTTGGGGAGGGATTGGTGTATGAATCAGTGGATGAAATCAACAGCTTCCCCCATTTCTACGGGCCGTCTCGGAGCTTC GTTCCTCTGCCGTTGGATGCGGTGACGAGATCTGAGAAGATTTCCTTGTCCGACGATGGGCAATTCAGCTGTGCTTTACTCGGTTAA
AA sequence Show only first row Show all	>Lus10038061 pacid=23163767 polypeptide=Lus10038061 locus=Lus10038061.g ID=Lus10038061.BGIv1.0 annot-version=v1.0 MEASGGSEKKLVYRISTAAEWEQFQKDGSTYGGEIDTSSRFIHLSDLNQVMSTLNNFFRNVDTDLFLLQIDAKKLGEGLVYESVDEINSFPHFYGPSRSF VPLPLDAVTRSEKISLSDDGQFSCALLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01897			unknown protein		Lus10038061 [exp]	0	1
AT5G54750			Transport protein particle (TR...		Lus10028720 [exp]	1.0	0.8736
AT1G74910			ADP-glucose pyrophosphorylase ...		Lus10032440 [exp]	1.4	0.8689
AT1G12840		ATVHA-C, DET3	DE-ETIOLATED 3, ARABIDOPSIS TH...		Lus10031990 [exp]	4.9	0.8089
AT5G56170		LLG1	LORELEI-LIKE-GPI-ANCHORED PROT...		Lus10000404 [exp]	6.3	0.7847
AT1G16240		ATSYP51, SYP51	syntaxin of plants 51 (.1.2.3)		Lus10002446 [exp]	7.1	0.7997
AT5G64130			cAMP-regulated phosphoprotein ...		Lus10036768 [exp]	8.3	0.7518
AT4G08520			SNARE-like superfamily protein...		Lus10037624 [exp]	8.5	0.7822
AT1G20540			Transducin/WD40 repeat-like su...		Lus10034576 [exp]	8.5	0.7620
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Lus10037143 [exp]	8.7	0.8084
AT5G61310			Cytochrome c oxidase subunit V...		Lus10025028 [exp]	9.5	0.7912

Compare expression of checked genes

Lus10038061 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.