Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72820 101 / 2e-27 Mitochondrial substrate carrier family protein (.1) AT5G26200 96 / 2e-25 Mitochondrial substrate carrier family protein (.1) AT5G15640 59 / 1e-11 Mitochondrial substrate carrier family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026468 [exp] 143 / 3e-43 AT5G26200 416 / 7e-146 Mitochondrial substrate carrier family protein (.1) Lus10026466 [exp] 140 / 4e-42 AT5G26200 409 / 5e-143 Mitochondrial substrate carrier family protein (.1) Lus10025015 [exp] 139 / 8e-42 AT5G26200 414 / 3e-145 Mitochondrial substrate carrier family protein (.1) Lus10041498 [exp] 54 / 6e-10 AT5G15640 494 / 2e-177 Mitochondrial substrate carrier family protein (.1) Lus10012597 [exp] 53 / 1e-09 AT5G15640 488 / 9e-173 Mitochondrial substrate carrier family protein (.1) Lus10031969 [exp] 53 / 2e-09 AT5G15640 404 / 3e-143 Mitochondrial substrate carrier family protein (.1) Lus10035134 [exp] 49 / 4e-08 AT5G15640 477 / 2e-170 Mitochondrial substrate carrier family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G223600 [exp] 127 / 3e-37 AT1G72820 429 / 7e-151 Mitochondrial substrate carrier family protein (.1) Potri.018G050300 [exp] 127 / 4e-37 AT1G72820 435 / 2e-153 Mitochondrial substrate carrier family protein (.1) Potri.017G098500 [exp] 54 / 4e-10 AT5G15640 460 / 3e-164 Mitochondrial substrate carrier family protein (.1) Potri.004G117000 [exp] 53 / 1e-09 AT5G15640 434 / 1e-153 Mitochondrial substrate carrier family protein (.1) Potri.008G100100 [exp] 47 / 2e-07 AT5G15640 338 / 5e-116 Mitochondrial substrate carrier family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00153 [flax] [poplar] Mito_carr Mitochondrial carrier protein
Representative CDS sequence Show only first row Show all	>Lus10038063 pacid=23163882 polypeptide=Lus10038063 locus=Lus10038063.g ID=Lus10038063.BGIv1.0 annot-version=v1.0 ATGAGCCTACGTGCCGCCGAAGAAGATTCACGATCAGAGATTCACATCCCAGCAGACATCGACTGGCAGATGATGGGCAAATCCAGGTTCTTCTTTCTCG AGGCAACACTCTTCTCCGACGTCTCGGCTGCTCTCTACCCGGTCGTCGTCCTCAAGACTCATTTACAAGTCATCCCAACTCAAATCTCATCTCTCAAACT GTCTCTCTCTATTATGAGCCACGAAGGCATTCGAGGATTCTACAAGGGTTTTGGGTTTTCTTAG
AA sequence Show only first row Show all	>Lus10038063 pacid=23163882 polypeptide=Lus10038063 locus=Lus10038063.g ID=Lus10038063.BGIv1.0 annot-version=v1.0 MSLRAAEEDSRSEIHIPADIDWQMMGKSRFFFLEATLFSDVSAALYPVVVLKTHLQVIPTQISSLKLSLSIMSHEGIRGFYKGFGFS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G72820			Mitochondrial substrate carrie...		Lus10038063 [exp]	0	1
AT1G75760			ER lumen protein retaining rec...		Lus10017213 [exp]	18.6	0.7721
AT3G12640			RNA binding (RRM/RBD/RNP motif...		Lus10015696 [exp]	19.7	0.7844
AT5G66770	GRAS		GRAS family transcription fact...		Lus10024014 [exp]	23.2	0.7624
AT1G62390		CLMP1, Phox2	Phox2, CLUMPED CHLOROPLASTS 1,...		Lus10029481 [exp]	28.9	0.7698
AT5G41460			Protein of unknown function (D...		Lus10017514 [exp]	40.8	0.7677
AT4G03430		EMB2770, STA1	STABILIZED 1, EMBRYO DEFECTIVE...		Lus10018580 [exp]	43.9	0.7641
AT1G62390		CLMP1, Phox2	Phox2, CLUMPED CHLOROPLASTS 1,...		Lus10039592 [exp]	45.6	0.7474
AT5G56680		SYNC1ARATH, SYN...	EMBRYO DEFECTIVE 2755, Class I...		Lus10012920 [exp]	47.3	0.7662
AT3G59420		ACR4	crinkly4 (.1)		Lus10000764 [exp]	48.6	0.7599
AT2G22370			unknown protein		Lus10023150 [exp]	51.9	0.7407

Compare expression of checked genes

Lus10038063 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.