Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G21910 37 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026473 [exp] 69 / 2e-15 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G220500 [exp] 39 / 0.0001 AT5G21910 40 / 7e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038069 pacid=23163780 polypeptide=Lus10038069 locus=Lus10038069.g ID=Lus10038069.BGIv1.0 annot-version=v1.0 ATGCCCACAGGGAGGAACATCCCCAGGTTTTCGTCTGAGGAGAGGGTGCTCGTCGTAAGCTTCAGCGTTTTGGCACTGATTTCCACTCTATATGTCAACC GTAAAGAAGATCCAGAACTTGACGAAGAAGCAGAAACATTCAGTTTCTTGTCTTTAGTGCCTCTGTTCCTCATTCTGCTCACCTTGGCCATAACCTTTTC GGTGTATCTGGATACCAACTTGGATCCCAACTGGATTCATAGATTTGGGGGCTCTTCTGGAGGTATTTTTGCAATCCTTCTTCTTCTTGCGTTGATCTTA AAGTGCAAGGAATCCATGCTCGACTGA
AA sequence Show only first row Show all	>Lus10038069 pacid=23163780 polypeptide=Lus10038069 locus=Lus10038069.g ID=Lus10038069.BGIv1.0 annot-version=v1.0 MPTGRNIPRFSSEERVLVVSFSVLALISTLYVNRKEDPELDEEAETFSFLSLVPLFLILLTLAITFSVYLDTNLDPNWIHRFGGSSGGIFAILLLLALIL KCKESMLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G21910			unknown protein		Lus10038069 [exp]	0	1
AT2G39440			unknown protein		Lus10040607 [exp]	1.0	0.9682
AT2G39440			unknown protein		Lus10018300 [exp]	2.8	0.9626
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10020191 [exp]	2.8	0.9585
AT1G73040			Mannose-binding lectin superfa...		Lus10037605 [exp]	3.0	0.9382
AT3G04030	GARP		Homeodomain-like superfamily p...		Lus10002629 [exp]	4.6	0.9613
AT5G22580			Stress responsive A/B Barrel D...		Lus10009407 [exp]	8.0	0.9223
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10020556 [exp]	8.2	0.9216
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10009833 [exp]	8.5	0.9209
AT3G04030	GARP		Homeodomain-like superfamily p...		Lus10020264 [exp]	10.0	0.9488
					Lus10019472 [exp]	10.9	0.9420

Compare expression of checked genes

Lus10038069 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.