Lus10038101 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11090 54 / 2e-09 serine-rich protein-related (.1)
AT5G25280 53 / 5e-09 serine-rich protein-related (.1.2)
AT1G67910 45 / 7e-07 unknown protein
AT1G24577 41 / 1e-05 unknown protein
AT5G20370 40 / 7e-05 serine-rich protein-related (.1)
AT3G13227 39 / 0.0001 serine-rich protein-related (.1)
AT5G55980 37 / 0.0006 serine-rich protein-related (.1)
AT3G56500 37 / 0.0006 serine-rich protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008811 115 / 1e-34 AT5G11090 61 / 2e-12 serine-rich protein-related (.1)
Lus10039998 57 / 2e-10 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2)
Lus10008808 56 / 4e-10 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2)
Lus10001946 52 / 6e-09 AT5G11090 179 / 9e-57 serine-rich protein-related (.1)
Lus10006660 52 / 1e-08 AT5G25280 144 / 4e-43 serine-rich protein-related (.1.2)
Lus10038100 50 / 5e-08 AT5G25280 145 / 4e-43 serine-rich protein-related (.1.2)
Lus10001928 49 / 8e-08 AT5G11090 177 / 3e-56 serine-rich protein-related (.1)
Lus10023632 40 / 3e-05 AT1G67910 48 / 1e-08 unknown protein
Lus10034901 40 / 4e-05 AT1G67910 49 / 6e-09 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G060700 81 / 1e-20 AT5G11090 66 / 4e-14 serine-rich protein-related (.1)
Potri.018G120300 78 / 1e-19 AT5G11090 67 / 1e-14 serine-rich protein-related (.1)
Potri.006G060800 50 / 4e-08 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2)
Potri.006G258600 50 / 4e-08 AT5G25280 181 / 1e-57 serine-rich protein-related (.1.2)
Potri.018G023300 49 / 1e-07 AT5G11090 194 / 1e-62 serine-rich protein-related (.1)
Potri.018G120400 46 / 1e-06 AT5G11090 126 / 3e-36 serine-rich protein-related (.1)
Potri.010G046700 40 / 4e-05 AT1G67910 82 / 4e-22 unknown protein
Potri.008G186200 38 / 0.0002 AT1G67910 85 / 4e-23 unknown protein
Potri.006G159300 37 / 0.0008 AT1G24577 43 / 5e-07 unknown protein
PFAM info
Representative CDS sequence
>Lus10038101 pacid=23163629 polypeptide=Lus10038101 locus=Lus10038101.g ID=Lus10038101.BGIv1.0 annot-version=v1.0
ATGGCTAATGCCTGTTATTCTTATCCCACCAATCCCGGAAAGAAGGGGACGACGTGCCTCTGTCTGCGCACCNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNGCTCCTGCCTGTGATTCTCATCCATCCAATCCGGGAAAGATGCGGACGACGTGCCTCTGCTCGCCTACCAACCATCCGGGGTCATTCCGATGCGC
AATCCACAAGAACAAGTCCAGATCACGGGAACTGACTTCCGCGGCGGCAAAGGCGTTCACATTGAGGGCGTTTCTACTGCAGATCATCAACCGGTCAAGC
AAGGACGTGAATCGCCGGAGGAATTTCCAGCCGAAGCAGTCCAGGTTTTGCACGATGAACAACGCTGATCATACAAACGGCGTCGTTGTTTCATAA
AA sequence
>Lus10038101 pacid=23163629 polypeptide=Lus10038101 locus=Lus10038101.g ID=Lus10038101.BGIv1.0 annot-version=v1.0
MANACYSYPTNPGKKGTTCLCLRTXXXXXXXXXXXAPACDSHPSNPGKMRTTCLCSPTNHPGSFRCAIHKNKSRSRELTSAAAKAFTLRAFLLQIINRSS
KDVNRRRNFQPKQSRFCTMNNADHTNGVVVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G11090 serine-rich protein-related (.... Lus10038101 0 1
AT3G46790 CRR2 CHLORORESPIRATORY REDUCTION 2,... Lus10001557 4.7 0.6771
AT2G40920 F-box and associated interacti... Lus10001579 8.0 0.6546
AT1G32640 bHLH JIN1, JAI1, ZBF... JASMONATE INSENSITIVE 1, Basic... Lus10030970 22.0 0.6535
AT4G30410 sequence-specific DNA binding ... Lus10015500 22.5 0.6534
AT5G47850 CCR4 CRINKLY4 related 4 (.1) Lus10012995 38.6 0.6211
AT3G15395 unknown protein Lus10027849 47.0 0.6138
AT1G68040 S-adenosyl-L-methionine-depend... Lus10007950 52.6 0.5999
Lus10035698 55.5 0.5805
AT2G39210 Major facilitator superfamily ... Lus10037949 60.0 0.5843
AT5G20230 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14,... Lus10025752 72.5 0.5792

Lus10038101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.