Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008034 [exp] 114 / 9e-34 ND / Lus10008816 [exp] 61 / 3e-13 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G059900 [exp] 42 / 7e-06 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038105 pacid=23163829 polypeptide=Lus10038105 locus=Lus10038105.g ID=Lus10038105.BGIv1.0 annot-version=v1.0 ATGATGCGACCCTCTCTGATTGCTTCTTTTCTACTGGTTTGGTTCCTCCTTCAACAAGCTCAAGGGATACGCCCACAGAAGAGATTCGTCGATCAAGCGG CAGCGGAGGAGAAGGAGAACAAGAAGATCTCAACATCGATCAAGGAAACAAGTGATGATATTCGCGATCATCGTATAATTAATAGTAATGGTGGAGTAGT GGTAGAAGAAGCAACAAGAGTTGCTTGCAAAGATGGACAACACTGTACTAGTGGTGATGAGATGAAGACAAGATCATCATCATCATCGTCGTCGTCGTAC CACTGGCTTCATGAAGATTACTATGGACCTAGGAGGCACAGACCTAGGCACCATTAA
AA sequence Show only first row Show all	>Lus10038105 pacid=23163829 polypeptide=Lus10038105 locus=Lus10038105.g ID=Lus10038105.BGIv1.0 annot-version=v1.0 MMRPSLIASFLLVWFLLQQAQGIRPQKRFVDQAAAEEKENKKISTSIKETSDDIRDHRIINSNGGVVVEEATRVACKDGQHCTSGDEMKTRSSSSSSSSY HWLHEDYYGPRRHRPRHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038105 [exp]	0	1
AT1G11260		ATSTP1, STP1	sugar transporter 1 (.1)		Lus10012596 [exp]	4.5	0.7901
AT1G52540			Protein kinase superfamily pro...		Lus10031673 [exp]	4.7	0.8498
AT2G42430	AS2	ASL18, LBD16	ASYMMETRIC LEAVES2-LIKE 18, la...		Lus10033872 [exp]	6.9	0.8564
AT5G03840		TFL-1, TFL1	TERMINAL FLOWER 1, PEBP (phosp...		Lus10021372 [exp]	8.8	0.8040
AT1G13340			Regulator of Vps4 activity in ...		Lus10017591 [exp]	11.5	0.7819
AT1G66980		GDPDL2, SNC4	Glycerophosphodiester phosphod...		Lus10040037 [exp]	13.0	0.8355
					Lus10019810 [exp]	14.1	0.8267
AT3G15280			unknown protein		Lus10005404 [exp]	14.4	0.7987
AT1G07175			unknown protein		Lus10018252 [exp]	20.8	0.7564
AT5G54010			UDP-Glycosyltransferase superf...		Lus10008453 [exp]	24.0	0.7951

Compare expression of checked genes

Lus10038105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.