Lus10038112 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06450 52 / 4e-08 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 44 / 2e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 43 / 3e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 42 / 5e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 42 / 6e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT2G32070 41 / 0.0002 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 40 / 0.0004 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008043 257 / 9e-87 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 214 / 8e-70 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017894 198 / 5e-66 AT1G06450 47 / 8e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 198 / 1e-63 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000561 193 / 1e-61 AT1G61470 143 / 1e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 193 / 8e-61 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035078 119 / 8e-33 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 110 / 1e-29 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10038113 81 / 6e-19 AT3G44240 140 / 3e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 57 / 4e-10 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 47 / 2e-06 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 44 / 1e-05 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 44 / 2e-05 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.006G262500 43 / 4e-05 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 42 / 5e-05 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10038112 pacid=23163758 polypeptide=Lus10038112 locus=Lus10038112.g ID=Lus10038112.BGIv1.0 annot-version=v1.0
ATGGCTAAGTTTTACGAGGAGACAGGGAGTGAAATCGGGCTGCAGAAGTTAGCCGATAATTTGGGGGTGAAGAGAAGAGGGGAAGCTCATACTGCCGCTT
CTGATAGTTTGTTGACTGCGCTTGTTTACTTCAAGTTGAAGAACAAGCTGATGATGTTGGGTGTTGGGGAAGAGGCTTATGTTGACTTCGTCTATGGAAT
TAGCACAAGGATCTCCAGGAACCAGAAAGAGCCCCTCTTTGTACCAACCACTCGACCAGGTATCGTGTATTATCATCATCATCCTTATCATTTTCATCAG
CGGAAGGTGGTGTTGTATCCAATTCCATATCAGCAGCCGAATGTGATGATGGGTCGTCGTTGGGTTGATTGCTCATTAGCTCCAACAGTATTGGTGTTTC
ATCTACTGATGATGGATGGATGGAATGCATCTGAATCTCTCTTTTTCTCAATCTCTCTTCCTTATTCTGTATATGATATTCTTTCCTTCTTTCATTCTTT
GTAA
AA sequence
>Lus10038112 pacid=23163758 polypeptide=Lus10038112 locus=Lus10038112.g ID=Lus10038112.BGIv1.0 annot-version=v1.0
MAKFYEETGSEIGLQKLADNLGVKRRGEAHTAASDSLLTALVYFKLKNKLMMLGVGEEAYVDFVYGISTRISRNQKEPLFVPTTRPGIVYYHHHPYHFHQ
RKVVLYPIPYQQPNVMMGRRWVDCSLAPTVLVFHLLMMDGWNASESLFFSISLPYSVYDILSFFHSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06450 Polynucleotidyl transferase, r... Lus10038112 0 1
AT3G04380 SDG31, SUVR4 SET DOMAIN PROTEIN 31, SET-dom... Lus10008198 35.9 0.4738
Lus10034814 117.1 0.4194
Lus10012495 122.0 0.4242
Lus10000882 200.4 0.3805

Lus10038112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.