Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44240 135 / 5e-39 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G06450 124 / 1e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT5G10960 121 / 3e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G80780 120 / 3e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3) AT1G61470 119 / 1e-32 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT2G32070 115 / 3e-31 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G44260 114 / 1e-30 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT5G22250 113 / 3e-30 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G15920 109 / 8e-29 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2) AT1G27820 107 / 1e-27 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008043 [exp] 366 / 1e-128 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10035077 [exp] 326 / 8e-113 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10017905 [exp] 310 / 2e-106 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10000327 [exp] 309 / 3e-106 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10035078 [exp] 307 / 1e-105 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10001651 [exp] 306 / 6e-104 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10000561 [exp] 291 / 2e-99 AT1G61470 143 / 1e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10017895 [exp] 202 / 5e-66 AT1G06450 98 / 4e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10007771 [exp] 177 / 2e-54 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G038700 [exp] 160 / 6e-48 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.001G046700 [exp] 125 / 5e-35 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.003G181100 [exp] 123 / 4e-34 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3) Potri.016G073000 [exp] 120 / 1e-32 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G187200 [exp] 119 / 1e-32 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G262500 [exp] 117 / 6e-32 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.018G020900 [exp] 117 / 9e-32 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G205600 [exp] 114 / 1e-30 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.004G200400 [exp] 112 / 5e-30 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.009G161500 [exp] 112 / 6e-30 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0219 [flax] [poplar] RNase_H PF04857 [flax] [poplar] CAF1 CAF1 family ribonuclease
Representative CDS sequence Show only first row Show all	>Lus10038113 pacid=23163869 polypeptide=Lus10038113 locus=Lus10038113.g ID=Lus10038113.BGIv1.0 annot-version=v1.0 ATGGAAGTATGTTTGGGTAAATACCCGTTTGTGTCGGTCGCCTCTGAATTTCCGGGTTTCCTCCGTCCAAGAGCGAGGTACGCTTCCGATGATGTCCGAT TAGAGAACTTGAAGTACAACGTCGGCACAACTTCTCTCATCCAATTAGGGCTCACTCTCTGCAATTCCAACGGCACCGTCGGCGGAGTTTGGCAGTTCAA TTTCCACTTCAACCTAGACCGCGACCTCCACTCGAAAGATTCCACCGATTTCTTGGCCCTCCACGGTATCGATTTCCAGAAATTGAAAACCCAGGGTGTC GACCGGGTCAAATTCGGCGCCATGTTCGGAGCGGTGATTGGGAGAAGGCGGAGTGCGATTATTGGGAGAAGGCGGAGTGCGATTACGTGGGTCACTTTCC ACGGAGTGTACGATTACGCCCATTTAGGGAAGGCGGTGACTTTCCGTCCGGCTGCGGAATCATCGGAAGAATTTTTTAATGTGTTGGGAAGAGGGTTTAA TTCGGTGGTGGATTGCAAGTATATGGCTAAGTTTTACGAGGAGACAGGGAGTGAAATCGGGCTGCAGAAGTTAGACGATAATTTGGGGGTGAAGAGAAGA GGGGAAGCTCATACTGCCGCTTCTGATAGTTTGTTGACCGCGCATTCCATATCAGCAGCCGAATGTGATGATGGGTCGTCGTTGGGTTGA
AA sequence Show only first row Show all	>Lus10038113 pacid=23163869 polypeptide=Lus10038113 locus=Lus10038113.g ID=Lus10038113.BGIv1.0 annot-version=v1.0 MEVCLGKYPFVSVASEFPGFLRPRARYASDDVRLENLKYNVGTTSLIQLGLTLCNSNGTVGGVWQFNFHFNLDRDLHSKDSTDFLALHGIDFQKLKTQGV DRVKFGAMFGAVIGRRRSAIIGRRRSAITWVTFHGVYDYAHLGKAVTFRPAAESSEEFFNVLGRGFNSVVDCKYMAKFYEETGSEIGLQKLDDNLGVKRR GEAHTAASDSLLTAHSISAAECDDGSSLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44240			Polynucleotidyl transferase, r...		Lus10038113 [exp]	0	1
AT4G26590		ATOPT5	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10022543 [exp]	5.6	0.7197
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008419 [exp]	16.5	0.6920
AT3G09150		ATHY2, GUN3, HY...	GENOMES UNCOUPLED 3, ARABIDOPS...		Lus10009713 [exp]	17.3	0.7182
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Lus10024492 [exp]	19.7	0.6586
AT4G00730	HD	AHDP, ANL2	ANTHOCYANINLESS 2, ARABIDOPSIS...		Lus10003299 [exp]	20.0	0.6854
AT5G07580	AP2_ERF		Integrase-type DNA-binding sup...		Lus10032498 [exp]	21.5	0.6807
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10039472 [exp]	29.9	0.6809
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10012510 [exp]	36.9	0.6342
AT1G25440	CO	COL16	B-box type zinc finger protein...		Lus10034322 [exp]	38.7	0.6739
AT2G41120			unknown protein		Lus10033361 [exp]	40.1	0.6779

Compare expression of checked genes

Lus10038113 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.