Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49920 43 / 1e-05 Octicosapeptide/Phox/Bem1p family protein (.1) AT4G05150 42 / 3e-05 Octicosapeptide/Phox/Bem1p family protein (.1) AT1G70640 41 / 3e-05 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008047 [exp] 251 / 1e-87 AT1G70640 43 / 2e-05 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1) Lus10022759 [exp] 99 / 6e-28 AT1G70640 49 / 3e-08 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1) Lus10010073 [exp] 104 / 4e-27 AT1G64260 155 / 3e-39 MuDR family transposase (.1) Lus10034643 [exp] 45 / 2e-06 AT2G01190 186 / 1e-53 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1) Lus10025941 [exp] 45 / 6e-06 AT3G24715 424 / 2e-129 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1) Lus10038159 [exp] 44 / 6e-06 AT3G24715 229 / 4e-62 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1) Lus10002588 [exp] 42 / 3e-05 AT4G05150 319 / 2e-104 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10018412 [exp] 41 / 8e-05 AT4G05150 304 / 1e-98 Octicosapeptide/Phox/Bem1p family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G041100 [exp] 44 / 1e-05 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.004G032200 [exp] 42 / 2e-05 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00564 [flax] [poplar] PB1 PB1 domain
Representative CDS sequence Show only first row Show all	>Lus10038115 pacid=23163683 polypeptide=Lus10038115 locus=Lus10038115.g ID=Lus10038115.BGIv1.0 annot-version=v1.0 ATGCCGAGGCCGAAGCTTATACTAATCTGCCAGTGTGGCGGGGATTTTCTGAAAGAGGATAATGGCTCCATGTCGTACAGCGGAGGAGATGCACACGCTG TGGATGTCAACCCAGACACTACGTTCGATGATCTCAAGGTTAGGGTGGCTCAGACTTGCAACTTAGACCTTCAATCCGTGTGCATTAAGTATTTCATCCC AGGAGTCAAGAAGATCCTCATTACTTTGGCCAATGATAAAGATTTCAAGACTATGTATGACTTCTACGGGGACTCCATTACCGCAGATATTTATGTTACT GGCACTCAAGGATTTGTTGCTGTTCAAGCTGCCCCGAAGACTGTTCAAGCAACCCCGAATAAGCGTCCTGCCTCGTAA
AA sequence Show only first row Show all	>Lus10038115 pacid=23163683 polypeptide=Lus10038115 locus=Lus10038115.g ID=Lus10038115.BGIv1.0 annot-version=v1.0 MPRPKLILICQCGGDFLKEDNGSMSYSGGDAHAVDVNPDTTFDDLKVRVAQTCNLDLQSVCIKYFIPGVKKILITLANDKDFKTMYDFYGDSITADIYVT GTQGFVAVQAAPKTVQATPNKRPAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G70640			octicosapeptide/Phox/Bem1p (PB...		Lus10038115 [exp]	0	1
AT1G70640			octicosapeptide/Phox/Bem1p (PB...		Lus10008047 [exp]	1.0	0.9754
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10042628 [exp]	3.5	0.9682
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10025169 [exp]	4.5	0.9690
AT2G24430	NAC	ANAC039, ANAC03...	Arabidopsis NAC domain contain...		Lus10022965 [exp]	4.5	0.9608
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10022082 [exp]	4.5	0.9638
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10016048 [exp]	5.5	0.9579
AT5G02950			Tudor/PWWP/MBT superfamily pro...		Lus10023486 [exp]	6.9	0.9573
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10025168 [exp]	7.4	0.9558
AT1G02060			Tetratricopeptide repeat (TPR)...		Lus10017658 [exp]	7.9	0.9412
AT4G28010			Tetratricopeptide repeat (TPR)...		Lus10017684 [exp]	9.4	0.9295

Compare expression of checked genes

Lus10038115 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.