Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14450 103 / 5e-31 NADH dehydrogenase (ubiquinone)s (.1) AT2G02510 101 / 3e-30 NADH dehydrogenase (ubiquinone)s (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005182 [exp] 113 / 7e-35 AT2G02510 110 / 6e-34 NADH dehydrogenase (ubiquinone)s (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G229900 [exp] 102 / 9e-31 AT1G14450 104 / 1e-31 NADH dehydrogenase (ubiquinone)s (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08122 [flax] [poplar] NDUF_B12 NADH-ubiquinone oxidoreductase B12 subunit family
Representative CDS sequence Show only first row Show all	>Lus10038124 pacid=23163894 polypeptide=Lus10038124 locus=Lus10038124.g ID=Lus10038124.BGIv1.0 annot-version=v1.0 ATGGGAAAACCTTTGGGAACAACAGGAGAATTCTTCCGGCGAAGGGATCAATGGAGGAAGCATCCCATGCTCACCAATCAGTTCCGTCACGCCCTTCCTG GATTTGGCATCGGCGTTACCGCTTTCGCTGTCTATCTCATCGGCGAGCAAATCTACAATAGGATCGGCGCCCCTTCCTCTCACGGCGCCTCCTCCTCCTC CTCTGCATCTCACTCTCACTGA
AA sequence Show only first row Show all	>Lus10038124 pacid=23163894 polypeptide=Lus10038124 locus=Lus10038124.g ID=Lus10038124.BGIv1.0 annot-version=v1.0 MGKPLGTTGEFFRRRDQWRKHPMLTNQFRHALPGFGIGVTAFAVYLIGEQIYNRIGAPSSHGASSSSSASHSH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14450			NADH dehydrogenase (ubiquinone...		Lus10038124 [exp]	0	1
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10043185 [exp]	1.7	0.8379
					Lus10031351 [exp]	4.7	0.8369
AT5G67320		HOS15	high expression of osmotically...		Lus10024972 [exp]	5.5	0.8231
AT4G19190			zinc knuckle (CCHC-type) famil...		Lus10035690 [exp]	6.5	0.8118
AT3G47810		ATVPS29, MAG1	VACUOLAR PROTEIN SORTING 29, M...		Lus10012851 [exp]	7.1	0.7698
AT3G48590	CCAAT	NF-YC1, ATHAP5A...	"nuclear factor Y, subunit C1"...		Lus10016750 [exp]	7.7	0.8339
AT4G35510			unknown protein		Lus10035988 [exp]	10.6	0.8055
AT5G37930			Protein with RING/U-box and TR...		Lus10028535 [exp]	12.0	0.7787
AT1G61730	GeBP		DNA-binding storekeeper protei...		Lus10010076 [exp]	12.2	0.8317
AT4G28100			unknown protein		Lus10039742 [exp]	13.6	0.7520

Compare expression of checked genes

Lus10038124 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.