Lus10038141 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17020 64 / 1e-12 ATSRG1, SRG1 senescence-related gene 1 (.1)
AT1G78550 57 / 5e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17010 54 / 6e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G25300 52 / 3e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G25310 44 / 2e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026173 164 / 5e-50 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1)
Lus10022292 65 / 1e-12 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1)
Lus10032574 64 / 1e-12 AT4G25300 419 / 2e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10015252 62 / 7e-12 AT1G17020 375 / 1e-129 senescence-related gene 1 (.1)
Lus10011981 58 / 3e-10 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1)
Lus10004582 55 / 2e-09 AT1G17020 231 / 2e-74 senescence-related gene 1 (.1)
Lus10011980 55 / 3e-09 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1)
Lus10011979 53 / 1e-08 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
Lus10011985 53 / 2e-08 AT1G17020 367 / 4e-126 senescence-related gene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G382400 76 / 1e-16 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1)
Potri.001G381700 69 / 3e-14 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1)
Potri.001G355100 64 / 2e-12 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1)
Potri.009G025900 61 / 2e-11 AT4G25300 410 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.009G022800 49 / 3e-07 AT1G17020 302 / 6e-101 senescence-related gene 1 (.1)
Potri.010G201000 43 / 4e-05 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G062500 39 / 0.0008 AT5G20400 432 / 2e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10038141 pacid=23158229 polypeptide=Lus10038141 locus=Lus10038141.g ID=Lus10038141.BGIv1.0 annot-version=v1.0
ATGGAAACCACAACAGAGCAGATGATGATGAGGCCTCCAACGAGGCATTCTTCGAAGCTAGGGAGGTCCCTTCTGGTGCCTAGTGTTCAGGAACTGGCAA
AATCTTCAACTCTCACAAATTCTACTTCTGTTCCTCTAAGGTACATAAGGGATCCTGACCAGCAGCTTCTGGATAAGCCCTCTAATGTCATGATCAATCA
CTGTAGTAACAAGAGCCCTGAAGACGAAGATGGCGATGATGATGATGAGGTGCCTGTAATTGACATGGAGAAGCTGCTTTCCCCTGAATCCATGCCTTCT
CAACTCTCCAAACTCCATTTTGCCTCCACCCACTGGGGTTTCTTCCAGGTTCCTTTTACTTCTTTCTCTTTTACCTGTTTGTTGGTTTATTGGCTTGTTA
TGGGCTACGAGTCCGAATTTAGAGTTAGAGAGAACGGAGTTATAACAAACCGTTTAACAATCATATACTAA
AA sequence
>Lus10038141 pacid=23158229 polypeptide=Lus10038141 locus=Lus10038141.g ID=Lus10038141.BGIv1.0 annot-version=v1.0
METTTEQMMMRPPTRHSSKLGRSLLVPSVQELAKSSTLTNSTSVPLRYIRDPDQQLLDKPSNVMINHCSNKSPEDEDGDDDDEVPVIDMEKLLSPESMPS
QLSKLHFASTHWGFFQVPFTSFSFTCLLVYWLVMGYESEFRVRENGVITNRLTIIY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10038141 0 1
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10042493 4.0 0.8898
Lus10036864 5.3 0.8396
AT3G45140 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGE... Lus10031237 5.7 0.8618
AT1G33030 O-methyltransferase family pro... Lus10009442 12.8 0.8822
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10014398 16.1 0.8477
AT2G42430 AS2 ASL18, LBD16 ASYMMETRIC LEAVES2-LIKE 18, la... Lus10014757 20.6 0.7599
AT1G17420 ATLOX3, LOX3 Arabidopsis thaliana lipoxygen... Lus10031239 21.9 0.7855
AT3G45140 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGE... Lus10031238 23.0 0.7876
AT5G59040 COPT3 copper transporter 3 (.1) Lus10021107 26.7 0.7749
AT4G23030 MATE efflux family protein (.1... Lus10017836 29.4 0.8169

Lus10038141 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.