Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20750 61 / 3e-12 GATA GATA29 GATA transcription factor 29 (.1) AT4G36620 56 / 3e-10 GATA GATA19, HANL2 hanaba taranu like 2, GATA transcription factor 19 (.1) AT2G18380 55 / 6e-10 GATA GATA20, HANL1 hanaba taranu like 1, GATA transcription factor 20 (.1) AT3G50870 55 / 8e-10 GATA GATA18, HAN, MNP MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) AT4G32890 53 / 5e-09 GATA GATA9 GATA transcription factor 9 (.1) AT5G25830 53 / 5e-09 GATA GATA12 GATA transcription factor 12 (.1) AT5G26930 50 / 8e-09 GATA GATA23 GATA transcription factor 23 (.1) AT3G54810 51 / 2e-08 GATA GATA8, BME3, BME3-ZF GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) AT5G49300 50 / 2e-08 GATA GATA16 GATA transcription factor 16 (.1) AT3G60530 50 / 5e-08 GATA GATA4 GATA transcription factor 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042504 [exp] 56 / 3e-10 AT3G20750 65 / 1e-12 GATA transcription factor 29 (.1) Lus10020684 [exp] 53 / 2e-09 AT4G16141 94 / 9e-24 GATA type zinc finger transcription factor family protein (.1) Lus10011430 [exp] 54 / 3e-09 AT4G32890 237 / 9e-77 GATA transcription factor 9 (.1) Lus10029863 [exp] 53 / 3e-09 AT4G16141 90 / 1e-22 GATA type zinc finger transcription factor family protein (.1) Lus10037572 [exp] 54 / 4e-09 AT4G32890 236 / 2e-76 GATA transcription factor 9 (.1) Lus10028301 [exp] 53 / 4e-09 AT3G50870 135 / 4e-39 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Lus10025829 [exp] 53 / 5e-09 AT4G32890 221 / 2e-70 GATA transcription factor 9 (.1) Lus10038273 [exp] 52 / 9e-09 AT4G32890 219 / 1e-69 GATA transcription factor 9 (.1) Lus10016849 [exp] 50 / 2e-08 AT3G06740 154 / 6e-49 GATA transcription factor 15 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G213300 [exp] 59 / 2e-11 AT3G20750 64 / 2e-12 GATA transcription factor 29 (.1) Potri.005G020500 [exp] 52 / 6e-09 AT3G06740 67 / 1e-14 GATA transcription factor 15 (.1) Potri.005G122700 [exp] 52 / 7e-09 AT3G50870 198 / 1e-62 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Potri.007G024500 [exp] 52 / 1e-08 AT3G50870 202 / 5e-64 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Potri.018G044900 [exp] 52 / 1e-08 AT5G25830 247 / 2e-79 GATA transcription factor 12 (.1) Potri.001G188500 [exp] 52 / 1e-08 AT4G32890 201 / 7e-63 GATA transcription factor 9 (.1) Potri.006G237700 [exp] 52 / 2e-08 AT5G25830 246 / 2e-79 GATA transcription factor 12 (.1) Potri.010G223300 [exp] 52 / 2e-08 AT3G54810 148 / 8e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.002G142800 [exp] 51 / 2e-08 AT3G60530 189 / 1e-59 GATA transcription factor 4 (.1) Potri.014G058600 [exp] 51 / 2e-08 AT3G60530 189 / 7e-60 GATA transcription factor 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00320 [flax] [poplar] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Lus10038150 pacid=23158155 polypeptide=Lus10038150 locus=Lus10038150.g ID=Lus10038150.BGIv1.0 annot-version=v1.0 ATGCAGGGTGGGGAGACCGATCTGAGAATCGGTTCAAGTAGTGGAATAGTGAATGAGCAATATGGATATGGAACTCCAACATTTGGTATGGTTAACAAAG ACCCAAACAACAACAACTACAACTACAACTACAACAACCCATCAGGTGTGGGAGTTCCGACATCAGCTGCGCTTGCTCCTCCTCTGGCCGCTCTTGCTCC TACTGATCAGGCTACCTTCGTTAATGATTTGATGATTCCCCGCAATCTAAAAAGGCGTTTGTTTTGCAACACATTTGACACTCCTATGTGGCGTCGCGGA CCTCTTGGCCCGAAGACGCTATGCAATGCGTGTGGACTTGAGTACCATAAGGATGAGAACAAAAACAAGGCAATGCAAGCTTCTACAAGCAATTGA
AA sequence Show only first row Show all	>Lus10038150 pacid=23158155 polypeptide=Lus10038150 locus=Lus10038150.g ID=Lus10038150.BGIv1.0 annot-version=v1.0 MQGGETDLRIGSSSGIVNEQYGYGTPTFGMVNKDPNNNNYNYNYNNPSGVGVPTSAALAPPLAALAPTDQATFVNDLMIPRNLKRRLFCNTFDTPMWRRG PLGPKTLCNACGLEYHKDENKNKAMQASTSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G20750	GATA	GATA29	GATA transcription factor 29 (...		Lus10038150 [exp]	0	1

Compare expression of checked genes

Lus10038150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.