Lus10038163 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26880 65 / 3e-14 Plant self-incompatibility protein S1 family (.1)
AT5G04350 61 / 1e-12 Plant self-incompatibility protein S1 family (.1)
AT4G29035 57 / 6e-11 Plant self-incompatibility protein S1 family (.1)
AT4G16295 57 / 8e-11 SPH1 S-protein homologue 1 (.1)
AT5G04347 55 / 2e-10 Plant self-incompatibility protein S1 family (.1)
AT1G28306 55 / 4e-10 Plant self-incompatibility protein S1 family (.1)
AT3G16970 55 / 4e-10 Plant self-incompatibility protein S1 family (.1)
AT3G17080 54 / 5e-10 Plant self-incompatibility protein S1 family (.1)
AT1G11765 54 / 6e-10 Plant self-incompatibility protein S1 family (.1)
AT5G12060 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025937 289 / 2e-100 AT3G26880 68 / 4e-14 Plant self-incompatibility protein S1 family (.1)
Lus10038164 271 / 2e-95 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1)
Lus10025935 270 / 3e-95 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1)
Lus10011897 91 / 5e-24 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1)
Lus10022831 84 / 3e-21 AT2G06090 63 / 2e-13 Plant self-incompatibility protein S1 family (.1)
Lus10011892 80 / 1e-19 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1)
Lus10022824 78 / 4e-19 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1)
Lus10011895 77 / 2e-18 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1)
Lus10002747 73 / 2e-17 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 77 / 9e-19 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 70 / 7e-16 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.004G199700 69 / 3e-15 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.010G008300 66 / 2e-14 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 56 / 2e-10 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 53 / 2e-09 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 49 / 7e-08 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.004G199801 48 / 2e-07 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.001G053100 45 / 9e-07 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 45 / 1e-06 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10038163 pacid=23158361 polypeptide=Lus10038163 locus=Lus10038163.g ID=Lus10038163.BGIv1.0 annot-version=v1.0
ATGAGCTCGCAAATGGTGATGTCAAAAATATTAGTGGCAGTCATTTTGGGAGCAATAATAACGGCAAGTCCGTCGGCGGCAACTCATTTTGACATCAATG
TTATCAACCAGTTAAGCCACGACCGCAAGCTATCAGTTCACTGCCAATCTAAGGACACCAATCTCGGCTCCCGGAAACTAGCCGTCGGCGAAGTTTATGG
ATGGGGCTTCTCCAGAAACATTTTTGGTACTACACTTTTCTGGTGCAATCTTTCTTGTCACGGTGGCCACAATCGTCTTTCGTTCAATGCGTACGATGAG
AGTCAAGGAAAGGGCATGAAACCAATTTACGAACTCAACTGGGAACTTAAGGATGATGGCCTTTATTTCCGGGACAAAGATTCGGGCATGGAAGTTATGG
TTGCACCATGGATGCAGCAGTAG
AA sequence
>Lus10038163 pacid=23158361 polypeptide=Lus10038163 locus=Lus10038163.g ID=Lus10038163.BGIv1.0 annot-version=v1.0
MSSQMVMSKILVAVILGAIITASPSAATHFDINVINQLSHDRKLSVHCQSKDTNLGSRKLAVGEVYGWGFSRNIFGTTLFWCNLSCHGGHNRLSFNAYDE
SQGKGMKPIYELNWELKDDGLYFRDKDSGMEVMVAPWMQQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26880 Plant self-incompatibility pro... Lus10038163 0 1
AT1G51990 O-methyltransferase family pro... Lus10002668 2.0 0.9253
AT1G69880 ATH8 thioredoxin H-type 8 (.1) Lus10037225 4.9 0.9323
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Lus10033405 7.9 0.9291
AT1G17050 SPS2 solanesyl diphosphate synthase... Lus10042491 9.5 0.8974
Lus10038232 10.4 0.9259
AT3G19910 RING/U-box superfamily protein... Lus10029693 11.6 0.9242
AT2G30540 Thioredoxin superfamily protei... Lus10040899 13.4 0.9172
Lus10015603 13.5 0.8889
AT1G35470 SPla/RYanodine receptor (SPRY)... Lus10009445 14.5 0.9188
AT3G07880 SCN1 SUPERCENTIPEDE1, Immunoglobuli... Lus10010491 17.9 0.8621

Lus10038163 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.