Lus10038164 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1)
AT5G04350 61 / 2e-12 Plant self-incompatibility protein S1 family (.1)
AT4G29035 57 / 8e-11 Plant self-incompatibility protein S1 family (.1)
AT4G16195 57 / 1e-10 Plant self-incompatibility protein S1 family (.1)
AT4G16295 56 / 1e-10 SPH1 S-protein homologue 1 (.1)
AT5G04347 54 / 8e-10 Plant self-incompatibility protein S1 family (.1)
AT5G27238 54 / 9e-10 Plant self-incompatibility protein S1 family (.1)
AT3G17080 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
AT1G11765 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
AT2G06090 52 / 5e-09 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038163 271 / 2e-95 AT3G26880 65 / 3e-14 Plant self-incompatibility protein S1 family (.1)
Lus10025937 274 / 2e-94 AT3G26880 68 / 4e-14 Plant self-incompatibility protein S1 family (.1)
Lus10025935 263 / 4e-92 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1)
Lus10011897 88 / 8e-23 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1)
Lus10022824 77 / 2e-18 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1)
Lus10011895 77 / 2e-18 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1)
Lus10022831 75 / 9e-18 AT2G06090 63 / 2e-13 Plant self-incompatibility protein S1 family (.1)
Lus10011892 73 / 6e-17 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1)
Lus10002747 67 / 3e-15 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 74 / 2e-17 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 71 / 4e-16 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.004G199700 66 / 2e-14 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.010G008300 66 / 2e-14 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 55 / 5e-10 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.003G175200 49 / 5e-08 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 48 / 1e-07 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 46 / 8e-07 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.004G199801 45 / 1e-06 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.018G148700 45 / 2e-06 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10038164 pacid=23158218 polypeptide=Lus10038164 locus=Lus10038164.g ID=Lus10038164.BGIv1.0 annot-version=v1.0
ATGTCAAAAATATTAGTGGCAGTCATTTTGGGAGCAATAGTAAACGCAACTCCATCGGCGGGAAATCAATTTTTCATAGCGGCAACGCATTTTGACATCA
ATGTCATCAACCAGTTAAGCCACGACCGCAAACTGTCAGTTCACTGCCAATCTAAAGACACCAATCTCGGCTCCCGAAAGTTAGCCGTCGGCGAAGTTTA
TGGATGGGGCTTCTCCAGAAACATTTTTGGTACTACACTTTTCTGGTGCAATCTTTCTTGTCACGGTGGCCACAATCGCCTTTCGTTCAATGCGTACGAT
GAAAGTCAAGGAAAGGGCATGAAACCAATTTACGAACTCAACTGGGAACTTAAGGATGATGGGCTTTATTTCCACGACAAAGATTCTGGCATGGAAGTTA
TGGTTGCTCCATGGATGCAGCAGTAG
AA sequence
>Lus10038164 pacid=23158218 polypeptide=Lus10038164 locus=Lus10038164.g ID=Lus10038164.BGIv1.0 annot-version=v1.0
MSKILVAVILGAIVNATPSAGNQFFIAATHFDINVINQLSHDRKLSVHCQSKDTNLGSRKLAVGEVYGWGFSRNIFGTTLFWCNLSCHGGHNRLSFNAYD
ESQGKGMKPIYELNWELKDDGLYFHDKDSGMEVMVAPWMQQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26880 Plant self-incompatibility pro... Lus10038164 0 1
AT2G05920 Subtilase family protein (.1) Lus10006689 2.6 0.9439
AT1G68630 PLAC8 family protein (.1) Lus10009036 3.2 0.9372
Lus10002237 5.7 0.9112
AT1G62935 unknown protein Lus10009297 5.9 0.9099
Lus10041745 6.9 0.9127
AT3G11480 BSMT1, ATBSMT1 S-adenosyl-L-methionine-depend... Lus10032299 7.9 0.8997
AT1G07476 unknown protein Lus10016504 8.3 0.7820
AT1G16160 WAKL5 wall associated kinase-like 5 ... Lus10013143 9.8 0.8885
AT3G25160 ER lumen protein retaining rec... Lus10038198 13.0 0.8362
AT3G11080 AtRLP35 receptor like protein 35 (.1) Lus10004307 14.0 0.8267

Lus10038164 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.