Lus10038168 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07090 363 / 7e-128 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 66 / 7e-13 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 64 / 4e-12 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 62 / 2e-11 PPPDE putative thiol peptidase family protein (.1.2)
AT4G31980 63 / 3e-11 unknown protein
AT5G47310 59 / 3e-10 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 59 / 4e-10 PPPDE putative thiol peptidase family protein (.1.2)
AT4G25680 59 / 5e-10 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 56 / 5e-09 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 55 / 1e-08 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025931 426 / 9e-153 AT3G07090 311 / 1e-107 PPPDE putative thiol peptidase family protein (.1)
Lus10043293 68 / 2e-13 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10019437 67 / 4e-13 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2)
Lus10005341 67 / 5e-13 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10041021 66 / 8e-13 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10013657 66 / 2e-12 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10018326 63 / 1e-11 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 62 / 2e-11 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10004372 64 / 3e-11 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G241700 379 / 7e-134 AT3G07090 366 / 1e-128 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 66 / 1e-12 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.006G154400 66 / 2e-12 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 65 / 2e-12 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.018G070600 65 / 2e-12 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G261500 64 / 6e-12 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 63 / 2e-11 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.002G134200 62 / 3e-11 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 62 / 4e-11 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 61 / 6e-11 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10038168 pacid=23158214 polypeptide=Lus10038168 locus=Lus10038168.g ID=Lus10038168.BGIv1.0 annot-version=v1.0
ATGGAAGAGGAGGGGCACAGGGTAACCTTGAATGTGTATGATCTCAGCCAAGGACTTGCACGCCAGCTCTCAACTACCTTCCTAGGGAAAGCAATTGAGG
GTATCTGGCATACCGGGGTGTCAGTGTATGGAAACGAATACTACTTTGGGGGAGGGATACAAAAGGACACAGCCGGAAGGACTCCGTACGGAACTCCCCT
CAAAGTAATCGAGCTGGGAGTAACGCATGTGCCCCAGGATGTATTTGAAATGTATTTGGATGAGATTAGCTCTCGGTATACAGCTGAAACCTACAGTTTA
CTCAAACACAATTGTAACAATTTTAGCAACGAGGTTGCACAGTTTTTGGTCGGAGCATCCATTCCAGATTACATTCTTCAGCTTCCTAATGAAGTTATGA
GCAGTCCGATGGGCTCTCTCATATTGCCCATGATACAGAATCTAGAGGCGACAATGAGAGCTGGGGCTGTACCGCAAGTACCGCAATTCAGGCCTACTGC
GGCCAGTCAGCAAGCACCGGCTAGCAATGGAGCTGCATCATCCGGTAATTCAGGAGAGAAGAAGCCATCTGTGAACTCTGTGCCTCCTGCTGTTGAGCCT
ACAAAAGAGAAGGAGAAAGCTTCGCCTTCTGCGGCTGATCCTCTTGGGGCTGCAAGAAGCAAAGTGCAGGAAGAGATCGGTAGAGAATTTGCTGCGATCA
TGGCTCAGGGATCCCTGCGGGCAAGTGAGGCTGCTGCTCTTGCGACGAGGAGAGTGATGCAGAGATATGGGAGTCTGAATGTTGGATCGCCGCGTAGTTA
A
AA sequence
>Lus10038168 pacid=23158214 polypeptide=Lus10038168 locus=Lus10038168.g ID=Lus10038168.BGIv1.0 annot-version=v1.0
MEEEGHRVTLNVYDLSQGLARQLSTTFLGKAIEGIWHTGVSVYGNEYYFGGGIQKDTAGRTPYGTPLKVIELGVTHVPQDVFEMYLDEISSRYTAETYSL
LKHNCNNFSNEVAQFLVGASIPDYILQLPNEVMSSPMGSLILPMIQNLEATMRAGAVPQVPQFRPTAASQQAPASNGAASSGNSGEKKPSVNSVPPAVEP
TKEKEKASPSAADPLGAARSKVQEEIGREFAAIMAQGSLRASEAAALATRRVMQRYGSLNVGSPRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07090 PPPDE putative thiol peptidase... Lus10038168 0 1
AT4G30480 TPR1, AtTPR1 tetratricopeptide repeat 1, Te... Lus10035117 2.4 0.8936
AT3G12050 Aha1 domain-containing protein... Lus10021072 3.3 0.9131
AT1G76060 EMB1793 EMBRYO DEFECTIVE 1793, LYR fam... Lus10005621 3.5 0.8793
AT1G16810 unknown protein Lus10026960 5.3 0.8941
AT5G12020 HSP17.6II 17.6 kDa class II heat shock p... Lus10026453 5.7 0.8985
AT1G11840 ATGLX1 glyoxalase I homolog (.1.2.3.4... Lus10002943 7.2 0.8784
AT1G07400 HSP20-like chaperones superfam... Lus10016456 8.5 0.9044
AT2G03690 coenzyme Q biosynthesis Coq4 f... Lus10026673 9.4 0.8806
AT5G47120 ATBI-1, ATBI1 ARABIDOPSIS BAX INHIBITOR 1, B... Lus10000097 10.5 0.8360
AT1G54115 ATCCX4 cation calcium exchanger 4 (.1... Lus10015668 10.6 0.8658

Lus10038168 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.