Lus10038170 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24820 162 / 2e-51 BSD domain-containing protein (.1)
AT1G69030 100 / 6e-26 BSD domain-containing protein (.1)
AT1G26300 98 / 7e-25 BSD domain-containing protein (.1.2)
AT5G65910 49 / 4e-07 BSD domain-containing protein (.1)
AT3G49800 44 / 2e-05 BSD domain-containing protein (.1)
AT1G10720 39 / 0.0007 BSD domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025929 338 / 2e-120 AT3G24820 161 / 2e-50 BSD domain-containing protein (.1)
Lus10036831 109 / 3e-29 AT1G26300 305 / 2e-103 BSD domain-containing protein (.1.2)
Lus10019194 105 / 3e-27 AT1G26300 294 / 8e-99 BSD domain-containing protein (.1.2)
Lus10011556 48 / 1e-06 AT3G49800 372 / 3e-126 BSD domain-containing protein (.1)
Lus10019271 48 / 1e-06 AT3G49800 370 / 3e-125 BSD domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G242200 185 / 2e-60 AT3G24820 167 / 4e-53 BSD domain-containing protein (.1)
Potri.008G111900 106 / 3e-28 AT1G69030 281 / 6e-94 BSD domain-containing protein (.1)
Potri.010G137900 97 / 1e-24 AT1G26300 241 / 2e-78 BSD domain-containing protein (.1.2)
Potri.014G008400 50 / 2e-07 AT3G49800 332 / 1e-109 BSD domain-containing protein (.1)
Potri.007G006400 46 / 4e-06 AT3G49800 288 / 1e-93 BSD domain-containing protein (.1)
Potri.014G014200 45 / 9e-06 AT1G10720 223 / 6e-68 BSD domain-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03909 BSD BSD domain
Representative CDS sequence
>Lus10038170 pacid=23158178 polypeptide=Lus10038170 locus=Lus10038170.g ID=Lus10038170.BGIv1.0 annot-version=v1.0
ATGAACTGGAAGTCATGGTTCGGAGCTCGCAGCTCAAGCGCTAACCCAACGCACCGTCAATCGACAGACGAAGATATTCTTGGACTTACCCAACAATTGA
TAGATCGCATCAAGTCCTTCAATCTTGATACCTTCAAGAACTTCCCACTCCATGATGACAGAAATGCAGAAGCTACCTTCGGCGACGAAACTGAAGGAAT
CGAAGCAGCTAACATTCATAGAGATCTCTCTGAATGGCAGGAAAGACATGCTACTCTTGCTCTTTCCAAATTCAAGGAACTTTCACAGCTTAGATTCAAG
TTATGCCCTCGCCACTTGAAAGAACGAGACTTTTGGAGGATCTATTTTACACTTGTCAAGGCCGACATAGTTGAGTATGAGCTACGGGCCATCCAATTAG
CTAAAGTTCAGAAGATGGCAACAGAGACTAGAAAATCTTCACAGGCCATCCCAGTTGAGGTTGAAATGGCAGAGACAGTGAAATCAACGAGCATACAACC
ACCAACTCCATGA
AA sequence
>Lus10038170 pacid=23158178 polypeptide=Lus10038170 locus=Lus10038170.g ID=Lus10038170.BGIv1.0 annot-version=v1.0
MNWKSWFGARSSSANPTHRQSTDEDILGLTQQLIDRIKSFNLDTFKNFPLHDDRNAEATFGDETEGIEAANIHRDLSEWQERHATLALSKFKELSQLRFK
LCPRHLKERDFWRIYFTLVKADIVEYELRAIQLAKVQKMATETRKSSQAIPVEVEMAETVKSTSIQPPTP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G24820 BSD domain-containing protein ... Lus10038170 0 1
AT5G40480 EMB3012 embryo defective 3012 (.1) Lus10002517 14.3 0.7123
AT1G71790 Subunits of heterodimeric acti... Lus10003086 14.9 0.7764
AT5G27430 Signal peptidase subunit (.1) Lus10040138 18.4 0.7589
AT1G71340 AtGDPD4 glycerophosphodiester phosphod... Lus10039158 22.2 0.7710
AT1G09850 XBCP3 xylem bark cysteine peptidase ... Lus10024296 26.2 0.7459
AT3G55020 Ypt/Rab-GAP domain of gyp1p su... Lus10036500 32.5 0.7412
AT1G79230 STR1, ATRDH1, A... ARABIDOPSIS THALIANA RHODANESE... Lus10031177 34.6 0.7562
AT3G58670 Protein of unknown function (D... Lus10033603 43.6 0.7530
AT2G27285 Coiled-coil domain-containing ... Lus10038787 43.8 0.7470
AT1G09980 Putative serine esterase fami... Lus10038351 44.4 0.7380

Lus10038170 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.