Lus10038185 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07170 213 / 1e-70 Sterile alpha motif (SAM) domain-containing protein (.1)
AT5G48680 176 / 5e-56 Sterile alpha motif (SAM) domain-containing protein (.1)
AT1G70180 72 / 7e-15 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
AT2G45700 46 / 7e-06 sterile alpha motif (SAM) domain-containing protein (.1)
AT5G23680 42 / 0.0002 Sterile alpha motif (SAM) domain-containing protein (.1)
AT3G48800 42 / 0.0002 Sterile alpha motif (SAM) domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022780 269 / 2e-92 AT3G07170 219 / 5e-73 Sterile alpha motif (SAM) domain-containing protein (.1)
Lus10025917 247 / 1e-84 AT3G07170 157 / 3e-49 Sterile alpha motif (SAM) domain-containing protein (.1)
Lus10011841 248 / 4e-81 AT3G07170 196 / 9e-61 Sterile alpha motif (SAM) domain-containing protein (.1)
Lus10014516 77 / 2e-16 AT1G70180 80 / 1e-16 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Lus10030825 65 / 2e-12 AT1G70180 104 / 8e-25 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Lus10030661 62 / 2e-11 AT1G70180 102 / 6e-24 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Lus10038078 44 / 3e-05 AT2G45700 767 / 0.0 sterile alpha motif (SAM) domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G244700 263 / 3e-90 AT3G07170 213 / 1e-70 Sterile alpha motif (SAM) domain-containing protein (.1)
Potri.014G190800 250 / 5e-85 AT3G07170 218 / 1e-72 Sterile alpha motif (SAM) domain-containing protein (.1)
Potri.008G193300 74 / 1e-15 AT1G70180 122 / 3e-31 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Potri.010G036500 71 / 1e-14 AT1G70180 134 / 1e-35 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Potri.006G218300 47 / 6e-06 AT2G45700 732 / 0.0 sterile alpha motif (SAM) domain-containing protein (.1)
Potri.012G104700 42 / 0.0002 AT3G48800 166 / 2e-49 Sterile alpha motif (SAM) domain-containing protein (.1)
Potri.015G104000 41 / 0.0003 AT3G48800 115 / 5e-30 Sterile alpha motif (SAM) domain-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0003 SAM PF00536 SAM_1 SAM domain (Sterile alpha motif)
Representative CDS sequence
>Lus10038185 pacid=23158402 polypeptide=Lus10038185 locus=Lus10038185.g ID=Lus10038185.BGIv1.0 annot-version=v1.0
ATGTATGCTGATAAAGTGGAAGCTTCGGGGAAAATGTCCGTGAAGGAGCGTCTCAATGGCAGTTCCGCCGCCGACTCTTCTCGCCGGAGACAAGTTACTA
GAAAAAGGCAAAGGCAAGATGACAAGTGGGAGCATGATCTCTTTGATGATGATGAACCGCGTACTTCAAATCGCAGAATTGATGGTCAAGATCTTCGACT
GAAGCTCCAGAAGAAAGTTCAAGCACCTCAAAGTGGGAGGGGAGGTGTGCGGGATTTGAGAGAGAAGCTATCTGGGACAGTGATTCCACAGCCGTTGAAT
TCTGATCCACCAAAGTCGAAACAAGAGGCTGCTAAACCAGCTAGGAGAAATGTTGCTGTTGAAGCTCCTGAACCACAGATTAAGAAAGTTGCCGGTGTAG
CCAGCAAAAAAAGGCCTCAGCAAAAGGCATCTTCTACTTCTGAGAATACATCAGTGGACAGCTTTTTGCAGTCATTAGGTCTTGAAAAGTACCTACTCAC
TTTTCAAGCTGAGGAAGTTGATATGACCGTCCTTGTACACATGACCGATGATGATCTTAAAGCTTTGGGAGTTCCAATGGGTCCAAGAAAGAAGATAATT
TTGGGATTGGAATCCAGAATCTAG
AA sequence
>Lus10038185 pacid=23158402 polypeptide=Lus10038185 locus=Lus10038185.g ID=Lus10038185.BGIv1.0 annot-version=v1.0
MYADKVEASGKMSVKERLNGSSAADSSRRRQVTRKRQRQDDKWEHDLFDDDEPRTSNRRIDGQDLRLKLQKKVQAPQSGRGGVRDLREKLSGTVIPQPLN
SDPPKSKQEAAKPARRNVAVEAPEPQIKKVAGVASKKRPQQKASSTSENTSVDSFLQSLGLEKYLLTFQAEEVDMTVLVHMTDDDLKALGVPMGPRKKII
LGLESRI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07170 Sterile alpha motif (SAM) doma... Lus10038185 0 1
AT1G54385 ARM repeat superfamily protein... Lus10007428 1.4 0.9121
AT5G55230 ATMAP65-1 microtubule-associated protein... Lus10032567 2.8 0.9082
AT4G34670 Ribosomal protein S3Ae (.1) Lus10041191 3.0 0.8946
AT1G60400 F-box/RNI-like superfamily pro... Lus10009224 4.5 0.8382
AT1G50000 methyltransferases (.1.2) Lus10035666 9.3 0.8137
AT3G55400 OVA1 OVULE ABORTION 1, methionyl-tR... Lus10001704 10.4 0.8300
AT3G02860 C2H2ZnF zinc ion binding (.1.2) Lus10037693 13.2 0.8294
AT1G52980 AtNug2 nuclear/nucleolar GTPase 2, GT... Lus10023835 14.8 0.8506
AT5G46290 KAS1, KAS I, KA... KETOACYL-ACP SYNTHASE 1, 3-ket... Lus10040883 16.6 0.8569
AT1G54385 ARM repeat superfamily protein... Lus10010672 19.0 0.8697

Lus10038185 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.