Lus10038188 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48660 231 / 6e-77 B-cell receptor-associated protein 31-like (.1)
AT3G07190 223 / 7e-74 B-cell receptor-associated protein 31-like (.1)
AT5G42570 133 / 7e-39 B-cell receptor-associated 31-like (.1)
AT1G11905 105 / 5e-28 B-cell receptor-associated protein 31-like (.1.2)
AT3G20450 82 / 1e-19 B-cell receptor-associated protein 31-like (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011842 290 / 3e-100 AT5G48660 270 / 1e-92 B-cell receptor-associated protein 31-like (.1)
Lus10022777 266 / 6e-91 AT5G48660 271 / 9e-93 B-cell receptor-associated protein 31-like (.1)
Lus10031546 124 / 6e-35 AT5G42570 287 / 3e-99 B-cell receptor-associated 31-like (.1)
Lus10030043 120 / 5e-34 AT5G42570 241 / 1e-81 B-cell receptor-associated 31-like (.1)
Lus10020025 108 / 4e-29 AT1G11905 225 / 9e-75 B-cell receptor-associated protein 31-like (.1.2)
Lus10035283 107 / 5e-29 AT5G42570 244 / 9e-83 B-cell receptor-associated 31-like (.1)
Lus10015132 107 / 1e-28 AT5G42570 258 / 7e-88 B-cell receptor-associated 31-like (.1)
Lus10025914 44 / 3e-06 AT3G07190 66 / 7e-15 B-cell receptor-associated protein 31-like (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G191500 261 / 9e-89 AT5G48660 237 / 2e-79 B-cell receptor-associated protein 31-like (.1)
Potri.002G245300 254 / 2e-86 AT3G07190 239 / 3e-80 B-cell receptor-associated protein 31-like (.1)
Potri.004G007900 128 / 8e-37 AT5G42570 259 / 3e-88 B-cell receptor-associated 31-like (.1)
Potri.011G007200 128 / 1e-36 AT5G42570 278 / 1e-95 B-cell receptor-associated 31-like (.1)
Potri.011G089100 100 / 4e-27 AT5G42570 140 / 5e-43 B-cell receptor-associated 31-like (.1)
Potri.014G154800 94 / 2e-23 AT5G42570 152 / 2e-46 B-cell receptor-associated 31-like (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05266 DUF724 Protein of unknown function (DUF724)
PF05529 Bap31 Bap31/Bap29 transmembrane region
Representative CDS sequence
>Lus10038188 pacid=23158380 polypeptide=Lus10038188 locus=Lus10038188.g ID=Lus10038188.BGIv1.0 annot-version=v1.0
ATGATGCAGCTGCTGTTCTTGGTTCTGTTCGCGGAAGTGGGCATAGCAATCTTGCTGCTGGTGAAGATTGGTCCACTGAGGGAGCTTGTAATGAAGAGTT
TGGATCAAGTGAAGATGGGGAAAGGTCCAGCCAGTGTGAAAACAATTGCTGGTACTATGTTTGTGATCCTCTTGTCTTACCTAATGAGCATTGTTAAGAT
CCAAAGCAAAGGCGCCAAGCTCGGCACTTTGTCCCCTATGGACCAAGTTCTCTGGAGAAGCCACTTGCTCGACGCTTCCCTCATCGGGTTTACATTGTTT
CTTGGGTTCGTAATCGACCGAATGCACCACTATCTGAAAAAGCTTATTGGTCTAAAGGGCAGAACGGGAGCAGTAAGAGAGGAATTTGAGAAGCTTCAGA
AGGAGAATGCTCAGCTTAAAGAGAAAGAAGAGAAAGCTTCCAAGGAAATGAATCAGCTTCAGGAGAAAATATCAGCACTGTCAGAAGATGTGAAGAAGCT
GAAGTTGGAAACAGAAGAAAAGGATAAGAAAGTTGAAACTGCAGAAGCACATGTTACAGCCCTCCAAAAGCAATCTGCAGATCTGTTGCTTGAGTATGAC
CGGTTGCTTGAAGACAACCAAAACCTACAGACTCAACAAGCACTAGGATACAAGCGTTGA
AA sequence
>Lus10038188 pacid=23158380 polypeptide=Lus10038188 locus=Lus10038188.g ID=Lus10038188.BGIv1.0 annot-version=v1.0
MMQLLFLVLFAEVGIAILLLVKIGPLRELVMKSLDQVKMGKGPASVKTIAGTMFVILLSYLMSIVKIQSKGAKLGTLSPMDQVLWRSHLLDASLIGFTLF
LGFVIDRMHHYLKKLIGLKGRTGAVREEFEKLQKENAQLKEKEEKASKEMNQLQEKISALSEDVKKLKLETEEKDKKVETAEAHVTALQKQSADLLLEYD
RLLEDNQNLQTQQALGYKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07190 B-cell receptor-associated pro... Lus10038188 0 1
AT1G06780 GAUT6 galacturonosyltransferase 6 (.... Lus10018773 1.0 0.8909
AT3G48750 CDKA1, CDC2A, C... cell division control 2 (.1) Lus10038754 2.0 0.8881
AT5G24580 Heavy metal transport/detoxifi... Lus10015583 3.2 0.8483
AT1G71360 Galactose-binding protein (.1) Lus10002929 4.0 0.8511
AT1G64760 O-Glycosyl hydrolases family 1... Lus10020261 6.5 0.8333
AT1G21870 GONST5 golgi nucleotide sugar transpo... Lus10025645 6.5 0.8529
AT1G30910 Molybdenum cofactor sulfurase ... Lus10007754 7.5 0.8300
AT4G08900 ARGAH1 arginine amidohydrolase 1, arg... Lus10030288 8.1 0.7860
AT4G14010 RALFL32 ralf-like 32 (.1) Lus10023223 8.4 0.8238
AT3G60030 SBP SPL12 squamosa promoter-binding prot... Lus10004523 9.8 0.8468

Lus10038188 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.