Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34770 107 / 7e-32 SAUR-like auxin-responsive protein family (.1) AT4G38840 107 / 7e-32 SAUR-like auxin-responsive protein family (.1) AT3G03840 107 / 1e-31 SAUR-like auxin-responsive protein family (.1) AT5G18020 103 / 3e-30 SAUR-like auxin-responsive protein family (.1) AT5G18030 102 / 4e-30 SAUR-like auxin-responsive protein family (.1) AT3G03850 102 / 4e-30 SAUR-like auxin-responsive protein family (.1) AT5G18080 102 / 5e-30 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18050 100 / 2e-29 SAUR-like auxin-responsive protein family (.1) AT5G18060 100 / 4e-29 SAUR-like auxin-responsive protein family (.1) AT2G21200 100 / 6e-29 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025909 [exp] 169 / 5e-56 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 149 / 2e-48 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 145 / 1e-46 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 143 / 6e-46 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 142 / 3e-45 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 141 / 3e-45 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 139 / 4e-44 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 136 / 4e-43 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 133 / 6e-42 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 125 / 9e-39 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 120 / 7e-37 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 118 / 4e-36 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 114 / 2e-34 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 113 / 3e-34 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 111 / 2e-33 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 110 / 8e-33 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 107 / 5e-32 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G165450 [exp] 100 / 8e-29 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 100 / 1e-28 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10038192 pacid=23158242 polypeptide=Lus10038192 locus=Lus10038192.g ID=Lus10038192.BGIv1.0 annot-version=v1.0 ATGGCTATTGGGTTGCCAGGTAGCCTAGCGAAGCAGATCCTCCGACGATCTGGCTCAGGATCGAGCAAATCATCTTCAAGGTTTCAAGATGCGGCAAAGG GGTTCTTAGCGGTGTATGTTGGAGAAGAGTTACATAGGAAGAGATTTGTTGTTCCAGTGTCCTATTTGAGCCAGCCTTTGTTTCAGGATTTGCTGAGCTT GGCTGAGGAGGAATTCGGGTTCGATCATCCAATGGGTGGATTGACCATTCCTTGCAGTGAAGAGACTTTTGCTTGTGTTACTTCAAGCTTGAGGAGACCA TCATGA
AA sequence Show only first row Show all	>Lus10038192 pacid=23158242 polypeptide=Lus10038192 locus=Lus10038192.g ID=Lus10038192.BGIv1.0 annot-version=v1.0 MAIGLPGSLAKQILRRSGSGSSKSSSRFQDAAKGFLAVYVGEELHRKRFVVPVSYLSQPLFQDLLSLAEEEFGFDHPMGGLTIPCSEETFACVTSSLRRP S

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34770			SAUR-like auxin-responsive pro...		Lus10038192 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10025911 [exp]	1.7	0.9069
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009624 [exp]	2.4	0.9180
AT4G38840			SAUR-like auxin-responsive pro...		Lus10010713 [exp]	3.2	0.8552
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009000 [exp]	3.7	0.9120
AT5G18050			SAUR-like auxin-responsive pro...		Lus10008994 [exp]	5.3	0.9036
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009627 [exp]	5.5	0.9003
AT4G38840			SAUR-like auxin-responsive pro...		Lus10010714 [exp]	6.5	0.8873
AT5G23530		ATCXE18	carboxyesterase 18 (.1)		Lus10039162 [exp]	7.3	0.8356
AT5G14510			ARM repeat superfamily protein...		Lus10022275 [exp]	7.5	0.8768
AT3G05880		RCI2A	RARE-COLD-INDUCIBLE 2A, Low te...		Lus10014028 [exp]	8.0	0.8442

Compare expression of checked genes

Lus10038192 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.