Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38840 115 / 8e-35 SAUR-like auxin-responsive protein family (.1) AT4G34770 106 / 2e-31 SAUR-like auxin-responsive protein family (.1) AT2G21200 105 / 3e-31 SAUR-like auxin-responsive protein family (.1) AT2G21210 105 / 5e-31 SAUR-like auxin-responsive protein family (.1) AT5G18020 104 / 7e-31 SAUR-like auxin-responsive protein family (.1) AT5G18030 104 / 1e-30 SAUR-like auxin-responsive protein family (.1) AT5G18080 103 / 1e-30 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18060 102 / 4e-30 SAUR-like auxin-responsive protein family (.1) AT5G18050 102 / 9e-30 SAUR-like auxin-responsive protein family (.1) AT5G18010 101 / 1e-29 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009628 [exp] 152 / 9e-50 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 152 / 9e-50 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 150 / 1e-48 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10009624 [exp] 136 / 3e-43 AT4G38840 119 / 9e-37 SAUR-like auxin-responsive protein family (.1) Lus10009627 [exp] 135 / 9e-43 AT4G38840 118 / 3e-36 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 135 / 9e-43 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 135 / 2e-42 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 134 / 3e-42 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10009000 [exp] 134 / 3e-42 AT4G38840 118 / 5e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 125 / 5e-39 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 120 / 4e-37 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 119 / 1e-36 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 116 / 2e-35 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 116 / 2e-35 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 110 / 7e-33 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 107 / 5e-32 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 107 / 6e-32 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 107 / 9e-32 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 106 / 2e-31 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10038193 pacid=23158407 polypeptide=Lus10038193 locus=Lus10038193.g ID=Lus10038193.BGIv1.0 annot-version=v1.0 ATGGCTATTGGATTGCCTGGTAATCTTGGTAAGCAAATTTTCAGAAGATCAGGTTCTGGCTCAAAGAAAGCATCTTCGAGGTTTACAGATGTGCCAAAGG GTCACTTAGCAGTGTATGTCGGAGAGAAACATAAGAAGAGATTTGTGGTACCGGTTTCATGTTTGAGCCACCCTTCATTTCAAGACTTGCTGAGCATGCC TGAAGAGGAATTTGGATTTGATCATCCTATGGGTGGATTGACCATCCCTTGCAGTGAAGAGACTTTTGTTTCTGTTGCTTCAAACTTGAGCAGACCATGA
AA sequence Show only first row Show all	>Lus10038193 pacid=23158407 polypeptide=Lus10038193 locus=Lus10038193.g ID=Lus10038193.BGIv1.0 annot-version=v1.0 MAIGLPGNLGKQIFRRSGSGSKKASSRFTDVPKGHLAVYVGEKHKKRFVVPVSCLSHPSFQDLLSMPEEEFGFDHPMGGLTIPCSEETFVSVASNLSRP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10038193 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10025910 [exp]	1.0	0.9637
AT1G04240	AUX_IAA	IAA3, SHY2	SHORT HYPOCOTYL 2, indole-3-ac...		Lus10024853 [exp]	2.8	0.9059
AT4G38840			SAUR-like auxin-responsive pro...		Lus10038191 [exp]	3.0	0.8824
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Lus10029038 [exp]	6.0	0.8394
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10002777 [exp]	8.2	0.8490
AT5G18020			SAUR-like auxin-responsive pro...		Lus10039020 [exp]	9.9	0.8319
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Lus10034227 [exp]	13.8	0.8222
AT5G43700	AUX_IAA	IAA4, ATAUX2-11	indole-3-acetic acid inducible...		Lus10018764 [exp]	17.9	0.8304
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10030518 [exp]	18.2	0.8266
AT5G50800		SWEET13, AtSWEE...	Nodulin MtN3 family protein (....		Lus10005935 [exp]	18.8	0.7444

Compare expression of checked genes

Lus10038193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.