Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61700 105 / 6e-32 RNA polymerases N / 8 kDa subunit (.1) AT1G11475 100 / 1e-29 NRPE10, NRPD10, NRPB10 RNA polymerases N / 8 kDa subunit (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025907 [exp] 142 / 1e-46 AT1G61700 105 / 5e-32 RNA polymerases N / 8 kDa subunit (.1) Lus10008095 [exp] 111 / 5e-34 AT1G61700 132 / 5e-42 RNA polymerases N / 8 kDa subunit (.1) Lus10013128 [exp] 109 / 7e-33 AT1G61700 129 / 1e-40 RNA polymerases N / 8 kDa subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G102900 [exp] 107 / 1e-32 AT1G61700 138 / 8e-45 RNA polymerases N / 8 kDa subunit (.1) Potri.006G136300 [exp] 107 / 1e-32 AT1G61700 138 / 8e-45 RNA polymerases N / 8 kDa subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01194 [flax] [poplar] RNA_pol_N RNA polymerases N / 8 kDa subunit
Representative CDS sequence Show only first row Show all	>Lus10038195 pacid=23158216 polypeptide=Lus10038195 locus=Lus10038195.g ID=Lus10038195.BGIv1.0 annot-version=v1.0 ATGGACAGTTGTTATTTTCAGGTGATTGGGCACAAATGGGATACTTACCTTGATCTCCTTCAAGCTGATTATACTGAAGGGGATGCCCTTGATGCATTGG GGTTGGTCCGTTATTGTTGCAGACGGATGCTCATGACCCATGTTGACCTCATCGAGAAGCTTCTTAACTACAATAGTAAGCCTCCCTCTCTCCCTCCCTT TCTGTGA
AA sequence Show only first row Show all	>Lus10038195 pacid=23158216 polypeptide=Lus10038195 locus=Lus10038195.g ID=Lus10038195.BGIv1.0 annot-version=v1.0 MDSCYFQVIGHKWDTYLDLLQADYTEGDALDALGLVRYCCRRMLMTHVDLIEKLLNYNSKPPSLPPFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10038195 [exp]	0	1
AT5G04280		AtRZ-1c	AtRZ-1c, RNA-binding (RRM/RBD/...		Lus10000128 [exp]	1.4	0.7727
AT4G38370			Phosphoglycerate mutase family...		Lus10023935 [exp]	1.7	0.7818
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10016452 [exp]	2.0	0.7535
AT3G43810		CAM7	calmodulin 7 (.1)		Lus10022589 [exp]	9.6	0.7561
AT3G09890			Ankyrin repeat family protein ...		Lus10023911 [exp]	11.5	0.7178
AT3G27050			unknown protein		Lus10010600 [exp]	12.2	0.6547
AT5G61310			Cytochrome c oxidase subunit V...		Lus10040012 [exp]	12.8	0.7070
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10038782 [exp]	13.4	0.7073
AT5G12320			ankyrin repeat family protein ...		Lus10036033 [exp]	22.6	0.7151
AT3G60480			unknown protein		Lus10034728 [exp]	28.9	0.6912

Compare expression of checked genes

Lus10038195 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.