Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31970 60 / 1e-12 CYP82C2, JAH1 "cytochrome P450, family 82, subfamily C, polypeptide 2", cytochrome P450, family 82, subfamily C, polypeptide 2 (.1) AT3G25180 58 / 9e-12 CYP82G1 cytochrome P450, family 82, subfamily G, polypeptide 1 (.1.2) AT4G31940 58 / 1e-11 CYP82C4 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) AT4G31950 54 / 2e-10 CYP82C3 "cytochrome P450, family 82, subfamily C, polypeptide 3", cytochrome P450, family 82, subfamily C, polypeptide 3 (.1) AT2G25160 50 / 4e-09 CYP82F1 "cytochrome P450, family 82, subfamily F, polypeptide 1", cytochrome P450, family 82, subfamily F, polypeptide 1 (.1) AT4G37370 47 / 6e-08 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT4G37360 45 / 3e-07 CYP81D2 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) AT1G66540 43 / 2e-06 Cytochrome P450 superfamily protein (.1.2) AT5G67310 41 / 9e-06 CYP81G1 "cytochrome P450, family 81, subfamily G, polypeptide 1", cytochrome P450, family 81, subfamily G, polypeptide 1 (.1) AT5G04330 41 / 1e-05 Cytochrome P450 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025901 [exp] 110 / 3e-30 AT4G31940 426 / 2e-144 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10038178 [exp] 67 / 4e-15 AT4G31940 425 / 3e-144 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10025902 [exp] 67 / 1e-14 AT4G31940 449 / 1e-153 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10025904 [exp] 66 / 1e-14 AT4G31940 413 / 3e-139 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10038200 [exp] 65 / 5e-14 AT4G31940 451 / 2e-154 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10025923 [exp] 63 / 2e-13 AT4G31970 420 / 4e-142 "cytochrome P450, family 82, subfamily C, polypeptide 2", cytochrome P450, family 82, subfamily C, polypeptide 2 (.1) Lus10032745 [exp] 59 / 4e-12 AT4G31940 571 / 0.0 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10007837 [exp] 57 / 2e-11 AT4G31940 575 / 0.0 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10028217 [exp] 56 / 8e-11 AT4G31970 292 / 2e-95 "cytochrome P450, family 82, subfamily C, polypeptide 2", cytochrome P450, family 82, subfamily C, polypeptide 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G334700 [exp] 72 / 6e-17 AT4G31970 459 / 1e-157 "cytochrome P450, family 82, subfamily C, polypeptide 2", cytochrome P450, family 82, subfamily C, polypeptide 2 (.1) Potri.014G037300 [exp] 71 / 3e-16 AT4G31940 629 / 0.0 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G037500 [exp] 71 / 3e-16 AT4G31940 717 / 0.0 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.016G008500 [exp] 65 / 4e-14 AT4G31940 499 / 2e-173 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.004G147600 [exp] 63 / 7e-14 AT4G31940 351 / 3e-119 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.009G108600 [exp] 62 / 3e-13 AT4G31940 555 / 0.0 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G037700 [exp] 61 / 1e-12 AT4G31940 508 / 1e-176 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G037600 [exp] 59 / 3e-12 AT4G31940 478 / 7e-165 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G037800 [exp] 59 / 4e-12 AT4G31940 495 / 9e-172 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G037400 [exp] 59 / 5e-12 AT4G31940 476 / 4e-164 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038201 pacid=23158283 polypeptide=Lus10038201 locus=Lus10038201.g ID=Lus10038201.BGIv1.0 annot-version=v1.0 ATGGGGTTTGCGTTGCAGGTTATGAATTTGACGCTAGCGAGGTTGCTGCAGAGTTTTAGCATTACGACACCGGGGGTTGATGATGAGGAGGTTGATATGG GTGAAGGAACGGGATTGACTTTGCCTAAAGCGACTCCATTGGAGGTTCGGATCGTTCCTCGCCTCCTTCCTCCACTCTATGAATAA
AA sequence Show only first row Show all	>Lus10038201 pacid=23158283 polypeptide=Lus10038201 locus=Lus10038201.g ID=Lus10038201.BGIv1.0 annot-version=v1.0 MGFALQVMNLTLARLLQSFSITTPGVDDEEVDMGEGTGLTLPKATPLEVRIVPRLLPPLYE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31970		CYP82C2, JAH1	"cytochrome P450, family 82, s...		Lus10038201 [exp]	0	1
AT5G51160			Ankyrin repeat family protein ...		Lus10029008 [exp]	2.4	0.8783
AT4G31950		CYP82C3	"cytochrome P450, family 82, s...		Lus10038202 [exp]	3.7	0.8477
AT4G24380			unknown protein		Lus10008722 [exp]	4.6	0.8224
AT4G04850		ATKEA3, KEA3	K+ efflux antiporter 3, K+ eff...		Lus10007104 [exp]	11.1	0.8186
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Lus10027434 [exp]	11.8	0.8007
AT3G55610		P5CS2	delta 1-pyrroline-5-carboxylat...		Lus10004696 [exp]	18.5	0.7811
AT5G13630		ABAR, CHLH, CCH...	ABA-BINDING PROTEIN, magnesium...		Lus10042061 [exp]	19.0	0.7847
AT4G04850		ATKEA3, KEA3	K+ efflux antiporter 3, K+ eff...		Lus10020485 [exp]	19.5	0.8183
					Lus10028601 [exp]	19.6	0.7372
AT2G38530		cdf3, LP2, LTP2	cell growth defect factor-3, l...		Lus10025152 [exp]	22.2	0.7632

Compare expression of checked genes

Lus10038201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.