Lus10038204 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13030 102 / 2e-25 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025900 258 / 3e-82 AT4G13030 277 / 4e-85 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G247400 165 / 3e-48 AT4G13030 292 / 8e-93 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.002G199700 56 / 2e-09 AT4G13030 125 / 9e-32 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.014G124300 56 / 3e-09 AT4G13030 112 / 4e-27 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.002G246900 46 / 2e-06 ND /
PFAM info
Representative CDS sequence
>Lus10038204 pacid=23158339 polypeptide=Lus10038204 locus=Lus10038204.g ID=Lus10038204.BGIv1.0 annot-version=v1.0
ATGAATAAACGCAGGGCTTACGCTGAAATATTGGCAAGTTATGATCAATTGAATGTGAGAAGTGAGGCCCTTCAAGATGCCAAGATCAAAATTTCGAGCT
ACACTCGTGGAAAATGGATTGAGAATGCTAGAGCAAGGAAATATTGCACCGATTATGTTCCCGAGACTACAACATTGTTACTTGTTGGTTCAAAAGGATC
TGGGAAAAGCAGTCTAATCAATCGGATTTCAAGGGTGTTTGGGAAGGATAAATTGGTGTCTGAAAGAGCGCAAGTATCATGTAATTCTTCTGTTGCTGAT
GGGACCTACTTCCTTCAGGAGTATATGATCCCTAGAAATTCAAGTTCATTCTGCGTTTATGATACCCGTGGCTTGTCTGATGATTCATCGGATAACATTG
AGATGCTCAAGCATTGGATGACTAAAGGTGTTCAGAAGGGGGAACTGATAATCAGGGAGGAGGCGGATGTGGACGAGATATTAGGAGCGGACGCTGAAGT
CTATGATGATGATGATGATGATCCGGTTTTCGTATTGACAGATGAGTGGAAGGAGTTCTTCGCTGCATCTGAAGCCAGGAGGCGACTAGGTCTTTAA
AA sequence
>Lus10038204 pacid=23158339 polypeptide=Lus10038204 locus=Lus10038204.g ID=Lus10038204.BGIv1.0 annot-version=v1.0
MNKRRAYAEILASYDQLNVRSEALQDAKIKISSYTRGKWIENARARKYCTDYVPETTTLLLVGSKGSGKSSLINRISRVFGKDKLVSERAQVSCNSSVAD
GTYFLQEYMIPRNSSSFCVYDTRGLSDDSSDNIEMLKHWMTKGVQKGELIIREEADVDEILGADAEVYDDDDDDPVFVLTDEWKEFFAASEARRRLGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G13030 P-loop containing nucleoside t... Lus10038204 0 1
AT5G45190 Cyclin family protein (.1.2) Lus10021927 4.5 0.8861
AT4G17380 MSH4, ATMSH4 ARABIDOPSIS MUTS HOMOLOG 4, M... Lus10007489 7.5 0.8563
AT3G45630 RNA binding (RRM/RBD/RNP motif... Lus10018125 10.8 0.8573
AT5G65290 LMBR1-like membrane protein (.... Lus10025735 12.7 0.8531
AT5G10650 RING/U-box superfamily protein... Lus10026226 15.2 0.8552
AT5G54520 Transducin/WD40 repeat-like su... Lus10014805 16.0 0.8369
AT4G00960 Protein kinase superfamily pro... Lus10015423 16.7 0.8372
AT4G32850 PAP(IV), PAP(IV... poly\(A\) polymerase IV, poly\... Lus10006029 18.2 0.8446
AT4G24970 Histidine kinase-, DNA gyrase ... Lus10022438 19.0 0.8310
AT2G20210 RNI-like superfamily protein (... Lus10011909 20.0 0.8490

Lus10038204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.