Lus10038213 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06320 44 / 1e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G202500 39 / 0.0003 AT1G06320 74 / 5e-17 unknown protein
PFAM info
Representative CDS sequence
>Lus10038213 pacid=23158158 polypeptide=Lus10038213 locus=Lus10038213.g ID=Lus10038213.BGIv1.0 annot-version=v1.0
ATGCAGAAAGTTCTGACGGAAGCATTGGGGGATCTGGATCTGATGGACCTCTCCCGCTCCACCACCATCCAGGAGCGCAGCACTGAGATATCCTCATCCG
CATCAATCACTCTGGAAGAATTGGCCGATGACCTGAACGAGCTGGATTGGCAGGAATGCTGCATCACCTCCGTAGAAGCTCTCTACTCCCAAAAAGGAGG
CAACGCTTCCACTGCGATTCACCAGGCCACCACCGATCTCTCCTTGACACAGCCAGCTGACACTTGTCCGCAATCCGATTCCCAATCTGTTTCTGCTCTC
AAGAAGAGGAAAATAATTTCTGCCCAAACACTGTACTCCACCAAAGAAGACGCTGCCCCAACGAGCCTCGATGCTACCGAGCCAGTCAAACTCAAGAAAC
AGCCTACTGCTGCATTCAAGAAGAGCAAAACAGCGTCTGTACAAAGTCGGTCCTCCAAAGACGACGATTCCCCCAATCGATCCGCTACTGAGACGACTAG
TTAA
AA sequence
>Lus10038213 pacid=23158158 polypeptide=Lus10038213 locus=Lus10038213.g ID=Lus10038213.BGIv1.0 annot-version=v1.0
MQKVLTEALGDLDLMDLSRSTTIQERSTEISSSASITLEELADDLNELDWQECCITSVEALYSQKGGNASTAIHQATTDLSLTQPADTCPQSDSQSVSAL
KKRKIISAQTLYSTKEDAAPTSLDATEPVKLKKQPTAAFKKSKTASVQSRSSKDDDSPNRSATETTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06320 unknown protein Lus10038213 0 1
AT2G45910 U-box domain-containing protei... Lus10016557 3.7 0.8108
AT4G35550 HD HB-4, WOX13, AT... WUSCHEL related homeobox 13 (.... Lus10016026 5.3 0.7277
AT3G11280 MYB Duplicated homeodomain-like su... Lus10014837 8.5 0.7695
AT2G45910 U-box domain-containing protei... Lus10040825 12.4 0.7519
AT4G12010 Disease resistance protein (TI... Lus10016029 16.9 0.6990
AT4G03230 S-locus lectin protein kinase ... Lus10038212 17.6 0.7025
AT5G03960 IQD12 IQ-domain 12 (.1) Lus10018029 21.2 0.6168
Lus10040028 21.3 0.6938
AT1G69360 Plant protein of unknown funct... Lus10036807 21.9 0.7063
AT3G49060 U-box domain-containing protei... Lus10014772 27.3 0.7272

Lus10038213 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.