Lus10038214 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G25210 102 / 2e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G27800 50 / 8e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G27300 50 / 1e-07 pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
AT4G01400 44 / 1e-05 unknown protein
AT1G30290 40 / 0.0004 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025890 187 / 3e-59 AT3G25210 430 / 6e-151 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10011029 54 / 7e-09 AT2G27800 430 / 1e-149 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002675 44 / 2e-05 AT4G01400 570 / 0.0 unknown protein
Lus10005303 40 / 0.0004 AT1G30290 1037 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10041542 40 / 0.0005 AT5G14080 671 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G248100 122 / 5e-34 AT3G25210 506 / 2e-180 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.019G103400 44 / 2e-05 AT1G03560 911 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.002G103600 43 / 3e-05 AT5G18475 546 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G093700 42 / 7e-05 AT2G27800 483 / 1e-169 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.011G082300 40 / 0.0003 AT1G30290 1015 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10038214 pacid=23158337 polypeptide=Lus10038214 locus=Lus10038214.g ID=Lus10038214.BGIv1.0 annot-version=v1.0
ATGTCTATCGCGTTACGGCGCTTCCTCGGGTCATCCTCCACCACCGGCCACAGGATTTCTTCGCTTCCACTTTTTCCTCTCCGTCGCCGTCTCCTCGTCT
CTTCATCATCCGACGCCGATACCCAAATTCCTGACTCATCCCACGATTCAGACCTCGACATCCCTCCACTCCCTATAACTCGAACCCGAACCCCACTCGA
AACCGGGTTCGAGTCCTGGATCCAGAAGCTAAAACCTGGGTTCACTCCGGCGGACGTAGAAGGCGCCATCCGAGCTCAGACGGACCCGGACCTCGCTCTC
GACATCTTCCGTTGGACAGCTCAGCAGCGCAACTACAAGCACAATCATGTCACCTACCTCACCATGATCAAGACTCTCATCAATGGGCGGCGCTACCGCC
ACGCCGCAACCCCGGTTGGCGGCGCTACCGCCACGACAAACATTTGGGTGAGAAATTAG
AA sequence
>Lus10038214 pacid=23158337 polypeptide=Lus10038214 locus=Lus10038214.g ID=Lus10038214.BGIv1.0 annot-version=v1.0
MSIALRRFLGSSSTTGHRISSLPLFPLRRRLLVSSSSDADTQIPDSSHDSDLDIPPLPITRTRTPLETGFESWIQKLKPGFTPADVEGAIRAQTDPDLAL
DIFRWTAQQRNYKHNHVTYLTMIKTLINGRRYRHAATPVGGATATTNIWVRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G25210 Tetratricopeptide repeat (TPR)... Lus10038214 0 1
AT4G30320 CAP (Cysteine-rich secretory p... Lus10015522 12.4 0.6312
AT1G65000 unknown protein Lus10026159 54.0 0.5697
AT1G76340 GONST3 golgi nucleotide sugar transpo... Lus10034674 68.8 0.5617
AT1G01390 UDP-Glycosyltransferase superf... Lus10005335 72.6 0.5674
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10025506 95.0 0.5727
AT2G15220 Plant basic secretory protein ... Lus10001358 106.2 0.5652
AT1G80600 WIN1 HOPW1-1-interacting 1 (.1) Lus10008025 147.5 0.5460
AT1G12064 unknown protein Lus10010487 170.0 0.5370
AT1G15460 ATBOR4 ARABIDOPSIS THALIANA REQUIRES ... Lus10013116 195.3 0.5324
AT4G36750 Quinone reductase family prote... Lus10024032 217.0 0.5294

Lus10038214 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.