Lus10038222 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G25280 189 / 3e-58 Major facilitator superfamily protein (.1)
AT3G25260 164 / 1e-48 Major facilitator superfamily protein (.1)
AT1G27040 150 / 4e-43 Major facilitator superfamily protein (.1.2)
AT1G69850 147 / 3e-42 NTL1, ATNRT1:2 nitrate transporter 1:2 (.1)
AT5G62730 134 / 2e-37 Major facilitator superfamily protein (.1)
AT1G33440 124 / 1e-33 Major facilitator superfamily protein (.1)
AT1G59740 116 / 9e-31 Major facilitator superfamily protein (.1)
AT3G21670 105 / 9e-27 Major facilitator superfamily protein (.1)
AT1G68570 102 / 1e-25 Major facilitator superfamily protein (.1)
AT1G12110 100 / 7e-25 CHL1-1, CHL1, B-1, ATNRT1, NRT1.1 CHLORINA 1, ARABIDOPSIS THALIANA NITRATE TRANSPORTER 1, nitrate transporter 1.1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025881 256 / 4e-84 AT3G25280 558 / 0.0 Major facilitator superfamily protein (.1)
Lus10013276 143 / 2e-40 AT1G69850 780 / 0.0 nitrate transporter 1:2 (.1)
Lus10030799 140 / 3e-39 AT1G69850 771 / 0.0 nitrate transporter 1:2 (.1)
Lus10036710 139 / 4e-39 AT1G69850 822 / 0.0 nitrate transporter 1:2 (.1)
Lus10037217 137 / 2e-38 AT1G69850 813 / 0.0 nitrate transporter 1:2 (.1)
Lus10033101 135 / 1e-37 AT5G62730 748 / 0.0 Major facilitator superfamily protein (.1)
Lus10015240 130 / 8e-36 AT1G69850 469 / 1e-159 nitrate transporter 1:2 (.1)
Lus10005417 129 / 1e-35 AT1G69850 446 / 1e-150 nitrate transporter 1:2 (.1)
Lus10024457 127 / 9e-35 AT1G59740 835 / 0.0 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G249100 202 / 2e-63 AT3G25280 498 / 7e-173 Major facilitator superfamily protein (.1)
Potri.010G034300 144 / 5e-41 AT1G69850 781 / 0.0 nitrate transporter 1:2 (.1)
Potri.012G070700 136 / 6e-38 AT1G69850 686 / 0.0 nitrate transporter 1:2 (.1)
Potri.005G001400 132 / 2e-36 AT1G59740 372 / 2e-121 Major facilitator superfamily protein (.1)
Potri.019G067500 126 / 2e-34 AT1G33440 734 / 0.0 Major facilitator superfamily protein (.1)
Potri.004G229000 122 / 7e-33 AT1G59740 808 / 0.0 Major facilitator superfamily protein (.1)
Potri.003G000800 119 / 1e-31 AT1G59740 821 / 0.0 Major facilitator superfamily protein (.1)
Potri.001G272900 115 / 1e-30 AT1G59740 407 / 1e-135 Major facilitator superfamily protein (.1)
Potri.008G061100 114 / 3e-30 AT3G53960 697 / 0.0 Major facilitator superfamily protein (.1)
Potri.014G036200 112 / 3e-29 AT1G27040 428 / 6e-144 Major facilitator superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00854 PTR2 POT family
Representative CDS sequence
>Lus10038222 pacid=23158260 polypeptide=Lus10038222 locus=Lus10038222.g ID=Lus10038222.BGIv1.0 annot-version=v1.0
ATGCACAGCGTTCGTACGAGGCAGAGTCCCCGCACGGTTCCACATCTACCAACAGCGCTCAAGAGGATCGGACTACGCCTGGCACTTGCCTCCATGTTCA
TGGCTGTGGCTGCAGTCATTGAGCATAAAAGGCGGACTGCTGATGCTCAGCTGTCCGTCTTTTGGCTGAGCTGGCAGTATTTTTTCTCAGGGGTATCGGA
TATGCTGACCCTTGGAGGGATGCTCGAGTTTTTCTACTTGGAGGCGCCTAGTAGCATGAGGAGCATGTGTACCGCATTGGCCTGGGCGTCGACTTCGATG
GGTTACTTCCTCAGCTCGGTTCTGGTCACTTTAATTAACGATGTAACGGGGAGACTCGGTACCCAGTGGCTCGGAGGTCAGGATTTGAATCGGAACCGGT
TGGATCTGTTCTATGCACTTCTTTGTATTCTGAATTCTGTGAATTTGGTGAACTATGTGGTCTGGGCTAAGAGGTACTAG
AA sequence
>Lus10038222 pacid=23158260 polypeptide=Lus10038222 locus=Lus10038222.g ID=Lus10038222.BGIv1.0 annot-version=v1.0
MHSVRTRQSPRTVPHLPTALKRIGLRLALASMFMAVAAVIEHKRRTADAQLSVFWLSWQYFFSGVSDMLTLGGMLEFFYLEAPSSMRSMCTALAWASTSM
GYFLSSVLVTLINDVTGRLGTQWLGGQDLNRNRLDLFYALLCILNSVNLVNYVVWAKRY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G25280 Major facilitator superfamily ... Lus10038222 0 1
AT4G04480 unknown protein Lus10015548 8.8 0.7323
AT1G04880 ARID HMG (high mobility group) box ... Lus10007127 8.9 0.7395
AT3G47490 HNH endonuclease (.1.2.3) Lus10034462 10.5 0.7529
AT2G28350 ARF ARF10 auxin response factor 10 (.1) Lus10016090 23.3 0.7299
AT5G50400 ATPAP27, PAP27 ARABIDOPSIS THALIANA PURPLE AC... Lus10037080 33.9 0.7280
AT4G02590 bHLH bHLH059, UNE12 unfertilized embryo sac 12, ba... Lus10002720 34.3 0.6916
AT5G44070 ATPCS1, ARA8, C... CADMIUM SENSITIVE 1, ARABIDOPS... Lus10003623 37.6 0.7127
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10017604 40.6 0.7141
AT3G62270 HCO3- transporter family (.1) Lus10032651 41.8 0.7093
AT2G18540 RmlC-like cupins superfamily p... Lus10041722 46.3 0.7211

Lus10038222 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.