Lus10038224 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07390 166 / 2e-50 AIR12 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1)
AT3G25290 145 / 2e-41 Auxin-responsive family protein (.1.2)
AT4G12980 142 / 7e-40 Auxin-responsive family protein (.1)
AT5G47530 105 / 2e-26 Auxin-responsive family protein (.1)
AT5G35735 102 / 2e-25 Auxin-responsive family protein (.1)
AT4G17280 99 / 7e-24 Auxin-responsive family protein (.1)
AT5G48750 95 / 3e-23 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT3G59070 93 / 1e-21 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT2G04850 78 / 2e-16 Auxin-responsive family protein (.1)
AT1G36580 42 / 9e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025879 408 / 5e-146 AT3G07390 181 / 3e-56 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1)
Lus10002274 108 / 4e-27 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1)
Lus10001734 105 / 2e-26 AT5G47530 422 / 9e-147 Auxin-responsive family protein (.1)
Lus10012350 102 / 3e-25 AT5G35735 418 / 3e-145 Auxin-responsive family protein (.1)
Lus10025878 88 / 4e-22 AT3G25290 88 / 8e-22 Auxin-responsive family protein (.1.2)
Lus10010498 86 / 5e-19 AT5G47530 412 / 1e-142 Auxin-responsive family protein (.1)
Lus10017564 82 / 1e-17 AT5G47530 419 / 8e-146 Auxin-responsive family protein (.1)
Lus10025877 76 / 1e-15 AT3G25290 387 / 2e-134 Auxin-responsive family protein (.1.2)
Lus10001736 70 / 1e-13 AT2G04850 559 / 0.0 Auxin-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G249200 235 / 6e-78 AT3G07390 158 / 3e-47 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1)
Potri.002G249300 157 / 5e-46 AT3G25290 452 / 6e-159 Auxin-responsive family protein (.1.2)
Potri.019G096400 116 / 3e-30 AT5G47530 309 / 2e-102 Auxin-responsive family protein (.1)
Potri.001G031600 113 / 3e-29 AT5G47530 312 / 7e-104 Auxin-responsive family protein (.1)
Potri.013G118300 113 / 4e-29 AT5G47530 305 / 7e-101 Auxin-responsive family protein (.1)
Potri.019G096300 112 / 5e-29 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.019G095800 112 / 6e-29 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.006G015000 110 / 4e-28 AT5G47530 513 / 0.0 Auxin-responsive family protein (.1)
Potri.014G162000 104 / 7e-26 AT5G47530 369 / 2e-126 Auxin-responsive family protein (.1)
Potri.010G156600 102 / 2e-25 AT5G47530 497 / 2e-176 Auxin-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04526 DUF568 Protein of unknown function (DUF568)
Representative CDS sequence
>Lus10038224 pacid=23158138 polypeptide=Lus10038224 locus=Lus10038224.g ID=Lus10038224.BGIv1.0 annot-version=v1.0
ATGGCGTCTCCCTTCTCTTTTCGCCTCGCCATTTCCATCTCTCTGCTACTCACCATCCCTGCACATTCCCTCACCTCCTCCTGCGATCAGAAGTTCAAAA
ACAACAAGATCTACGCCAATTGCACATCCCTCCCTGCTCTCTCCTCCATCCTACACTACACCTTCAACGCCACCAATTCCTCCCTCTCCGTCGCCTTCGT
CGCCGCCCCACCCAGCCCCGACGGCTGGGTCGCCTGGGGGATCAACCCCGACGGCACCGGAATGTCCGGCGCTCAGGCTCTTGTCGCCCTCCCCGGCGCC
GGCGGAAGCCTTGTCGTCAAGACCTACAACCTCATATCCTACGGCAGCATCAAGGAGGAGAAGCTCTCCTTCGACGTGTGGGATGTCGAAGTCGAGTCCA
TGAACGGCACCACCGCCATTTTCGCCTCCGTCAAGATCCCCGCCGGAGCCGAGAAGGTGAACCACATCTGGCAGGTCGGCGCCGCGGTTAACAAAGGGAG
TCCTGGTAAGCACGAGTTTGCCCCCTCAAATCTGGCTGCTAAGGAGACTCTTCAGTTGACCGGCAGCCCCGCTCCTGCTCCGGGTTCTTCTCCGGCGCCG
GCTAGCGCCGCGTCTAGCGGGTTCGGTTCTGATAATGGCACAAGTGGTGGTTACAGTTACAGGGGAAGGGAGATGAAGGTTGGATTGTATGGTGGGGTGG
CGTTGATTGTTCTCGCTGGGCTGACCATTGGGTTGTAA
AA sequence
>Lus10038224 pacid=23158138 polypeptide=Lus10038224 locus=Lus10038224.g ID=Lus10038224.BGIv1.0 annot-version=v1.0
MASPFSFRLAISISLLLTIPAHSLTSSCDQKFKNNKIYANCTSLPALSSILHYTFNATNSSLSVAFVAAPPSPDGWVAWGINPDGTGMSGAQALVALPGA
GGSLVVKTYNLISYGSIKEEKLSFDVWDVEVESMNGTTAIFASVKIPAGAEKVNHIWQVGAAVNKGSPGKHEFAPSNLAAKETLQLTGSPAPAPGSSPAP
ASAASSGFGSDNGTSGGYSYRGREMKVGLYGGVALIVLAGLTIGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07390 AIR12 Auxin-Induced in Root cultures... Lus10038224 0 1
AT3G62660 GATL7 galacturonosyltransferase-like... Lus10002440 1.4 0.9437
AT2G39220 PLP6, PLAIIB ,P... PATATIN-like protein 6 (.1) Lus10038350 1.4 0.9462
AT1G56430 ATNAS4 ARABIDOPSIS THALIANA NICOTIANA... Lus10010917 3.9 0.9122
AT1G31320 AS2 LBD4 LOB domain-containing protein ... Lus10018275 4.8 0.9023
AT4G18760 AtRLP51 receptor like protein 51 (.1) Lus10007294 6.0 0.9336
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10034289 9.6 0.9403
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Lus10019929 12.2 0.9391
AT1G21510 unknown protein Lus10028651 14.3 0.9378
AT5G12890 UDP-Glycosyltransferase superf... Lus10031248 15.9 0.9205
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Lus10002978 16.5 0.9327

Lus10038224 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.