Lus10038225 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G25290 257 / 5e-85 Auxin-responsive family protein (.1.2)
AT4G12980 251 / 1e-82 Auxin-responsive family protein (.1)
AT5G47530 232 / 4e-75 Auxin-responsive family protein (.1)
AT5G35735 221 / 1e-70 Auxin-responsive family protein (.1)
AT4G17280 218 / 9e-70 Auxin-responsive family protein (.1)
AT3G59070 143 / 3e-40 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT2G04850 141 / 4e-40 Auxin-responsive family protein (.1)
AT3G07570 121 / 2e-32 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT3G61750 109 / 6e-28 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT5G48750 68 / 2e-13 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025877 402 / 7e-143 AT3G25290 387 / 2e-134 Auxin-responsive family protein (.1.2)
Lus10012350 238 / 3e-77 AT5G35735 418 / 3e-145 Auxin-responsive family protein (.1)
Lus10006398 233 / 2e-76 AT5G47530 276 / 2e-91 Auxin-responsive family protein (.1)
Lus10002274 232 / 6e-75 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1)
Lus10001734 222 / 6e-71 AT5G47530 422 / 9e-147 Auxin-responsive family protein (.1)
Lus10017564 197 / 2e-61 AT5G47530 419 / 8e-146 Auxin-responsive family protein (.1)
Lus10010498 192 / 2e-59 AT5G47530 412 / 1e-142 Auxin-responsive family protein (.1)
Lus10001736 147 / 3e-42 AT2G04850 559 / 0.0 Auxin-responsive family protein (.1)
Lus10001162 147 / 4e-42 AT2G04850 563 / 0.0 Auxin-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G249300 294 / 2e-99 AT3G25290 452 / 6e-159 Auxin-responsive family protein (.1.2)
Potri.006G015000 230 / 2e-74 AT5G47530 513 / 0.0 Auxin-responsive family protein (.1)
Potri.010G156200 225 / 2e-72 AT5G47530 472 / 1e-166 Auxin-responsive family protein (.1)
Potri.010G156600 225 / 2e-72 AT5G47530 497 / 2e-176 Auxin-responsive family protein (.1)
Potri.016G010900 224 / 5e-72 AT5G47530 498 / 8e-177 Auxin-responsive family protein (.1)
Potri.014G162000 216 / 1e-68 AT5G47530 369 / 2e-126 Auxin-responsive family protein (.1)
Potri.002G222700 214 / 3e-68 AT5G35735 369 / 8e-126 Auxin-responsive family protein (.1)
Potri.001G031600 160 / 4e-47 AT5G47530 312 / 7e-104 Auxin-responsive family protein (.1)
Potri.019G095800 158 / 2e-46 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.019G096300 158 / 2e-46 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10038225 pacid=23158438 polypeptide=Lus10038225 locus=Lus10038225.g ID=Lus10038225.BGIv1.0 annot-version=v1.0
ATGTATTTTCTTAATACGCTAAGGGGGGCTCTGGATTTGAAAAGAGGGCAGAGTGTTGACGTCGCTGGGGGAGGAAACTCCGGCCTAAAGAAAAAGAACA
TTCACGGTGCTTTGAATGCGGTGAGCTGGGGAATTCTGTTTCCGGTGGGAGCGATAATCGCTAGGTACGTGAGAAGTTTCCCGTCCGCGGATCCAACTTG
GTTTTATCTCCATGCTGGCTGTCAGGTCTCCGGCTATGCAATCGGAGTATCAGGATGGGCAACCGGGATGAAGCTGGGAAGTCAATCCAAAGGGATTCAG
TTCACAGGTCACCGTAACATTGGAATTGCTCTTTTCGCAATAGCAACTCTCCAGATGTTTGCGCTGTTCTTGAGACCATCGAAAGAGCATAAGTTGAGAA
AGTACTGGAATGTCTACCACCACGGAGCTGGATACGCCATACCTGTGCTGGGATTACTGAACGTGTTCAAGGGTCTAGACATGTTGCAGCCGGAGAGCAA
GTGGAGGACGGCGTATATAGCTGTGATTGCTGCACTGGGTGGGATCGCAGTGTTGTTGGAAATCGTCACTTGGATTATGGTTCTGAGGAGGAAATCCAAT
CAATCCACCAAACCTTACGATGGCGGATACAGCAACAATGGGCATAGCAGGCAGCAACAACCCCTCACTTCTTAG
AA sequence
>Lus10038225 pacid=23158438 polypeptide=Lus10038225 locus=Lus10038225.g ID=Lus10038225.BGIv1.0 annot-version=v1.0
MYFLNTLRGALDLKRGQSVDVAGGGNSGLKKKNIHGALNAVSWGILFPVGAIIARYVRSFPSADPTWFYLHAGCQVSGYAIGVSGWATGMKLGSQSKGIQ
FTGHRNIGIALFAIATLQMFALFLRPSKEHKLRKYWNVYHHGAGYAIPVLGLLNVFKGLDMLQPESKWRTAYIAVIAALGGIAVLLEIVTWIMVLRRKSN
QSTKPYDGGYSNNGHSRQQQPLTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G25290 Auxin-responsive family protei... Lus10038225 0 1
AT1G79820 SGB1 SUPPRESSOR OF G PROTEIN BETA1,... Lus10025800 4.9 0.9301
AT5G22930 Protein of unknown function (D... Lus10038677 4.9 0.9252
AT5G55950 Nucleotide/sugar transporter f... Lus10022563 5.0 0.9486
AT2G14740 VSR2;2, BP80-2;... VACUOLAR SORTING RECEPTOR 3, V... Lus10002130 8.4 0.9464
AT5G18280 ATAPY2 apyrase 2 (.1.2) Lus10003270 11.6 0.9226
AT5G60720 Protein of unknown function, D... Lus10016114 13.2 0.9403
AT2G01070 Lung seven transmembrane recep... Lus10005732 13.4 0.9185
AT5G60720 Protein of unknown function, D... Lus10021450 14.3 0.9386
AT1G29890 RWA4 REDUCED WALL ACETYLATION 4, O-... Lus10000367 16.6 0.9379
AT2G38060 PHT4;2 phosphate transporter 4;2 (.1) Lus10027761 18.2 0.9340

Lus10038225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.