Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07410 327 / 9e-115 AtRABA5b RAB GTPase homolog A5B (.1) AT2G43130 321 / 1e-112 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G05810 320 / 2e-111 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) AT2G31680 311 / 1e-108 AtRABA5d RAB GTPase homolog A5D (.1) AT5G47520 270 / 3e-92 AtRABA5a RAB GTPase homolog A5A (.1) AT4G18430 234 / 3e-78 AtRABA1e RAB GTPase homolog A1E (.1) AT1G07410 233 / 8e-78 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT3G12160 231 / 6e-77 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) AT4G39990 231 / 7e-77 ATGB3, AtRABA4b, AtRab11G ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A 4B, GTP-BINDING PROTEIN 3, RAB GTPase homolog A4B (.1) AT1G09630 229 / 1e-76 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025876 [exp] 412 / 1e-148 AT1G05810 331 / 1e-116 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10026731 [exp] 326 / 2e-114 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10025516 [exp] 326 / 2e-114 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10038807 [exp] 263 / 1e-89 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1) Lus10000536 [exp] 256 / 6e-87 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1) Lus10017558 [exp] 256 / 8e-87 AT5G47520 367 / 1e-130 RAB GTPase homolog A5A (.1) Lus10023153 [exp] 235 / 1e-78 AT5G65270 396 / 3e-142 RAB GTPase homolog A4A (.1) Lus10035924 [exp] 234 / 3e-78 AT5G65270 404 / 3e-145 RAB GTPase homolog A4A (.1) Lus10000637 [exp] 234 / 4e-78 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G249500 [exp] 339 / 1e-119 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Potri.002G231800 [exp] 326 / 2e-114 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.014G150300 [exp] 323 / 3e-113 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.006G015400 [exp] 264 / 7e-90 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1) Potri.016G010300 [exp] 263 / 1e-89 AT5G47520 395 / 7e-142 RAB GTPase homolog A5A (.1) Potri.006G000300 [exp] 234 / 3e-78 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.011G070300 [exp] 232 / 2e-77 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.003G004100 [exp] 231 / 6e-77 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.001G270100 [exp] 231 / 7e-77 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.010G197200 [exp] 230 / 8e-77 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10038226 pacid=23158345 polypeptide=Lus10038226 locus=Lus10038226.g ID=Lus10038226.BGIv1.0 annot-version=v1.0 ATGGGTGAATCACAGGCGGATATAGGAGGAGGAGAAGGGGGAGAGGAGTATCTGTTCAAGATAGTAGTCATTGGCGACTCCGCAGTCGGCAAATCCAACT TACTCTCCAGATTCGCCACCAACGAATTCGACCCCAACTCCAAAGCCACCATTGGCGTCGAGTTCCAGACTCAAGTAGTCGAAATCGACGGCAAAGAAAT CAAAGCCCAGATCTGGGACACCGCCGGACAGGAGCGCTTCCGTGCCGTCACCTCCGCCTACTACAGGGGGGCCGTCGGTGCTCTCATCGTCTACGACATC ACCCGCAAGACCACCTTCGAAAGCGTCAAACGCTGGCTCCAAGAGCTCACCTTGCAGTGCGATACGACGGTGGGGAAGATGCTGGTGGGGAACAAGTGCG ATCTGGACGAGATTAGGGAAGTGAGCAAAGAGGAAGGGAAGAGGGTCGCTGAGGAAGAAGGATTGTTCTTCATGGAGACATCTGCTCTGGATTCAACCAA CGTGGAGGCTGCGTTTGAGGTTGTGATTCGTGAGATTTACAACAATCTCAGCAGGAAGTCTTTGAAGTCGGACTCTTATAAGGCTGCTTTGACTGTCAAC AGAGTCACGCTAGTCAACTCAGAATCCAAGCCTCGCAGTATGTCCTCCTGCTGCTCATCTTCTTGA
AA sequence Show only first row Show all	>Lus10038226 pacid=23158345 polypeptide=Lus10038226 locus=Lus10038226.g ID=Lus10038226.BGIv1.0 annot-version=v1.0 MGESQADIGGGEGGEEYLFKIVVIGDSAVGKSNLLSRFATNEFDPNSKATIGVEFQTQVVEIDGKEIKAQIWDTAGQERFRAVTSAYYRGAVGALIVYDI TRKTTFESVKRWLQELTLQCDTTVGKMLVGNKCDLDEIREVSKEEGKRVAEEEGLFFMETSALDSTNVEAAFEVVIREIYNNLSRKSLKSDSYKAALTVN RVTLVNSESKPRSMSSCCSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05810		ARA, Ara-1, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10038226 [exp]	0	1
AT1G11770			FAD-binding Berberine family p...		Lus10023366 [exp]	1.7	0.9318
AT5G56350			Pyruvate kinase family protein...		Lus10010329 [exp]	2.4	0.8942
AT5G48540			receptor-like protein kinase-r...		Lus10038227 [exp]	3.5	0.9136
AT4G16490			ARM repeat superfamily protein...		Lus10039047 [exp]	5.1	0.8852
AT2G33580			Protein kinase superfamily pro...		Lus10042225 [exp]	5.7	0.8751
AT2G47420		DIM1A	adenosine dimethyl transferase...		Lus10017864 [exp]	6.2	0.8693
AT4G22780		ACR7	ACT domain repeat 7 (.1)		Lus10006662 [exp]	7.4	0.8855
AT4G00090			Transducin/WD40 repeat-like su...		Lus10030275 [exp]	7.7	0.8584
AT3G05370		AtRLP31	receptor like protein 31 (.1)		Lus10000228 [exp]	8.5	0.8545
AT3G47520		pNAD-MDH, MDH	plastidic NAD-dependent malate...		Lus10000275 [exp]	8.8	0.8786

Compare expression of checked genes

Lus10038226 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.