Lus10038229 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025871 86 / 5e-23 AT3G07425 50 / 4e-09 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G250100 37 / 0.0002 AT3G07425 49 / 6e-09 unknown protein
PFAM info
Representative CDS sequence
>Lus10038229 pacid=23158439 polypeptide=Lus10038229 locus=Lus10038229.g ID=Lus10038229.BGIv1.0 annot-version=v1.0
ATGGTGCCAAGCTCCAATTCGCTAGTGAGATGGTGCCAGCCGCAGCGGCGGTCAATGAGGCGGCGGAGGGGTAGCACTATAAGGCTGGGGAGCCGACGGC
GGCGTGGGTTCTTGCTGGGGACCAGGCGGACGGTTCGATGGGGTTTGGTGGTGGCGGCTCCTCTAAGAATGCTCAAGAAAATGATGATGAAATTAGCTTC
TCCAACTGCTAGTACTAGTACTGCTGCTGCTGGTTATGCTGATTTAGAGGCTTACTATCGTAATTTTCCATTTTTACGTCCTCAGATATTTCCCCTTTGT
TGA
AA sequence
>Lus10038229 pacid=23158439 polypeptide=Lus10038229 locus=Lus10038229.g ID=Lus10038229.BGIv1.0 annot-version=v1.0
MVPSSNSLVRWCQPQRRSMRRRRGSTIRLGSRRRRGFLLGTRRTVRWGLVVAAPLRMLKKMMMKLASPTASTSTAAAGYADLEAYYRNFPFLRPQIFPLC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07425 unknown protein Lus10038229 0 1
AT3G10410 CPY, SCPL49 CARBOXYPEPTIDASE Y, SERINE CAR... Lus10037958 12.0 0.8466
AT3G11330 PIRL9 plant intracellular ras group-... Lus10017948 16.9 0.8285
AT5G43330 c-NAD-MDH2 cytosolic-NAD-dependent malate... Lus10041144 17.3 0.8174
AT2G36530 ENO2, LOS2 LOW EXPRESSION OF OSMOTICALLY ... Lus10003374 17.4 0.8414
AT2G36530 ENO2, LOS2 LOW EXPRESSION OF OSMOTICALLY ... Lus10002844 26.5 0.8380
AT2G30340 AS2 LBD13 LOB domain-containing protein ... Lus10009930 27.9 0.8155
AT2G35120 Single hybrid motif superfamil... Lus10018319 37.5 0.8130
AT5G37790 Protein kinase superfamily pro... Lus10028518 41.4 0.7929
AT3G12110 ACT11 actin-11 (.1) Lus10005457 52.5 0.8217
AT5G43330 c-NAD-MDH2 cytosolic-NAD-dependent malate... Lus10021870 57.0 0.8183

Lus10038229 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.