Lus10038232 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025868 137 / 4e-43 ND /
Lus10020401 41 / 2e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10038232 pacid=23158302 polypeptide=Lus10038232 locus=Lus10038232.g ID=Lus10038232.BGIv1.0 annot-version=v1.0
ATGGCAACTACTCAGGTTGAGGCAGGGCAAGCAGAGAAGTCAATTCAAGAAGTGGCATCGGATGATCATCCTCAAGAAGAGAAGCAATCAGAAGTGGTGG
TGGATGAAGAAGAAAATGGTACGAAACAGCAGGTGAAGGGGAAAAGCCAGGAGGAGAGTGGAGGGGATCAAGAAGATGACGAGGATGAGATGTGGCCGCC
GGCTGAACACCATTTGCCTGCTGCAGTTTCCGGCGAAGACGTTGACGAGCCTGAAGGTGGGTCGGCCGCTGTTCCTTCGTTCGATGATGAAGAAGACGAG
GACGACCAAGGCAAAGATGACGAAGAAGATGAAGAGGACATGTGA
AA sequence
>Lus10038232 pacid=23158302 polypeptide=Lus10038232 locus=Lus10038232.g ID=Lus10038232.BGIv1.0 annot-version=v1.0
MATTQVEAGQAEKSIQEVASDDHPQEEKQSEVVVDEEENGTKQQVKGKSQEESGGDQEDDEDEMWPPAEHHLPAAVSGEDVDEPEGGSAAVPSFDDEEDE
DDQGKDDEEDEEDM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10038232 0 1
Lus10025868 1.0 0.9829
AT2G36650 unknown protein Lus10014389 1.7 0.9687
AT1G69880 ATH8 thioredoxin H-type 8 (.1) Lus10037225 2.0 0.9656
Lus10032860 2.4 0.9724
AT2G36650 unknown protein Lus10023883 3.2 0.9622
AT3G19910 RING/U-box superfamily protein... Lus10029693 4.2 0.9550
AT4G05430 Carbohydrate-binding X8 domain... Lus10038529 5.1 0.9473
Lus10010378 6.3 0.9545
AT1G55790 Domain of unknown function (DU... Lus10039534 6.4 0.9194
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Lus10033405 6.5 0.9549

Lus10038232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.