Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71950 120 / 7e-36 Proteinase inhibitor, propeptide (.1) AT5G11940 67 / 1e-13 Subtilase family protein (.1) AT1G66220 65 / 5e-13 Subtilase family protein (.1) AT4G10530 61 / 1e-11 Subtilase family protein (.1) AT4G10520 61 / 1e-11 Subtilase family protein (.1) AT4G10550 61 / 2e-11 Subtilase family protein (.1.2.3) AT4G21326 59 / 6e-11 ATSBT3.12 subtilase 3.12 (.1) AT4G21640 57 / 2e-10 Subtilase family protein (.1) AT1G32960 57 / 3e-10 ATSBT3.3 Subtilase family protein (.1) AT4G21323 56 / 4e-10 Subtilase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025848 [exp] 141 / 1e-44 AT1G71950 97 / 5e-27 Proteinase inhibitor, propeptide (.1) Lus10002964 [exp] 73 / 9e-16 AT5G59100 624 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Lus10042555 [exp] 73 / 1e-15 AT5G59100 603 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Lus10009867 [exp] 60 / 2e-11 AT5G59190 629 / 0.0 subtilase family protein (.1) Lus10039085 [exp] 58 / 2e-10 AT5G59810 827 / 0.0 Subtilase family protein (.1) Lus10039087 [exp] 56 / 6e-10 AT2G04160 810 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Lus10032424 [exp] 54 / 8e-10 AT2G04160 123 / 3e-33 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Lus10013154 [exp] 56 / 9e-10 AT3G14067 915 / 0.0 Subtilase family protein (.1) Lus10039086 [exp] 56 / 1e-09 AT5G59810 850 / 0.0 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G112800 [exp] 139 / 2e-43 AT1G71950 129 / 2e-39 Proteinase inhibitor, propeptide (.1) Potri.019G083300 [exp] 137 / 1e-42 AT1G71950 130 / 8e-40 Proteinase inhibitor, propeptide (.1) Potri.011G150900 [exp] 69 / 1e-14 AT1G32960 744 / 0.0 Subtilase family protein (.1) Potri.001G450600 [exp] 65 / 3e-13 AT1G32960 772 / 0.0 Subtilase family protein (.1) Potri.010G196800 [exp] 63 / 2e-12 AT5G59100 599 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.001G002200 [exp] 61 / 8e-12 AT4G26330 891 / 0.0 UNFERTILIZED EMBRYO SAC 17, Subtilisin-like serine endopeptidase family protein (.1) Potri.012G133200 [exp] 61 / 1e-11 AT5G59090 646 / 0.0 subtilase 4.12 (.1.2.3) Potri.011G151200 [exp] 61 / 2e-11 AT1G32960 906 / 0.0 Subtilase family protein (.1) Potri.001G450401 [exp] 59 / 4e-11 AT4G10550 938 / 0.0 Subtilase family protein (.1.2.3) Potri.011G050300 [exp] 57 / 2e-10 AT2G04160 786 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0570 [flax] [poplar] PPP-I PF05922 [flax] [poplar] Inhibitor_I9 Peptidase inhibitor I9
Representative CDS sequence Show only first row Show all	>Lus10038252 pacid=23158475 polypeptide=Lus10038252 locus=Lus10038252.g ID=Lus10038252.BGIv1.0 annot-version=v1.0 ATGCTCTTCCCACCAAAATCCTCTTCGCTTGTAATCGTCGTCTCCGCATTCATCGTTATTATCGCTGCTATGGCCGACTCCGCTCCTTCTGTTGTCCAGC CGGCGGATTCTTCCTCCGCCTCCGCTGAAGCCGCTGTTCATATCGTCTACACTGAAAGGCCAGAGGGAAACGAACAGCCCGAGGCCTATCACATCCGAAC CCTCGCTTCCGTCCTCGGCAGCGAGCAGGCTGCGAAGGACGCTTTGCTTTACAGCTACAAGACGGCTGCTTCTGGCTTCTCTGCTAAGCTTACTCCCGAC CAAGTCGAACAGATGTCGAAACAACCTGGTGTTCTTCAAGTTGTCCCAAGCAGGAGTCTTCAGCTGCATTCTGGACCTGGGATGCTTCACTAG
AA sequence Show only first row Show all	>Lus10038252 pacid=23158475 polypeptide=Lus10038252 locus=Lus10038252.g ID=Lus10038252.BGIv1.0 annot-version=v1.0 MLFPPKSSSLVIVVSAFIVIIAAMADSAPSVVQPADSSSASAEAAVHIVYTERPEGNEQPEAYHIRTLASVLGSEQAAKDALLYSYKTAASGFSAKLTPD QVEQMSKQPGVLQVVPSRSLQLHSGPGMLH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G71950			Proteinase inhibitor, propepti...		Lus10038252 [exp]	0	1
AT5G50720		ATHVA22E	ARABIDOPSIS THALIANA HVA22 HOM...		Lus10032557 [exp]	1.4	0.8904
AT2G17350			unknown protein		Lus10013847 [exp]	1.7	0.8873
AT1G08970	CCAAT	NF-YC9, HAP5C	"nuclear factor Y, subunit C9"...		Lus10004468 [exp]	2.6	0.8920
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Lus10039037 [exp]	2.8	0.8741
AT4G38090			Ribosomal protein S5 domain 2-...		Lus10035937 [exp]	3.6	0.8700
AT1G02070			unknown protein		Lus10009267 [exp]	4.9	0.8823
AT5G39360		EDL2	EID1-like 2 (.1)		Lus10025639 [exp]	5.0	0.8786
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10023428 [exp]	5.5	0.8781
AT1G29800			RING/FYVE/PHD-type zinc finger...		Lus10029271 [exp]	7.3	0.8722
AT4G23630		RTNLB1, BTI1	Reticulan like protein B1, VIR...		Lus10014948 [exp]	7.5	0.8456

Compare expression of checked genes

Lus10038252 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.