Plant FIBer expression Database

Lus10038263 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33270 103 / 4e-28 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
AT4G33260 101 / 3e-27 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2)
AT5G27945 94 / 2e-24 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G27570 92 / 5e-24 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1)
AT5G27080 89 / 2e-22 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1)
AT5G26900 88 / 3e-22 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1)
AT4G11920 78 / 1e-18 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1)
AT4G22910 75 / 1e-17 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
AT5G13840 72 / 1e-16 FZR3 FIZZY-related 3 (.1.2)
AT1G18080 40 / 3e-05 RACK1A_AT, ATARCA RECEPTOR FOR ACTIVATED C KINASE 1 A, Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037595
[exp]
119 / 2e-35 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10025838
[exp]
117 / 1e-34 AT4G33270 295 / 3e-99 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10037593
[exp]
116 / 2e-32 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10006853
[exp]
114 / 2e-31 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10006851
[exp]
110 / 2e-30 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10034687
[exp]
104 / 3e-28 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10011833
[exp]
99 / 3e-27 AT4G33270 255 / 4e-83 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10029716
[exp]
88 / 8e-24 AT4G33270 193 / 1e-60 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10042765
[exp]
89 / 8e-23 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G118400
[exp]
107 / 4e-29 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.019G021800
[exp]
99 / 3e-26 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.013G048900
[exp]
98 / 6e-26 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.016G068700
[exp]
79 / 6e-19 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.003G119500
[exp]
75 / 2e-17 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Potri.001G112700
[exp]
74 / 4e-17 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Potri.008G057500
[exp]
68 / 5e-15 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2)
Potri.010G202100
[exp]
68 / 5e-15 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2)
Potri.015G110300
[exp]
67 / 9e-15 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.015G041600
[exp]
42 / 5e-06 AT1G18080 537 / 0.0 RECEPTOR FOR ACTIVATED C KINASE 1 A, Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Lus10038263 pacid=23158502 polypeptide=Lus10038263 locus=Lus10038263.g ID=Lus10038263.BGIv1.0 annot-version=v1.0
ATGACTCTTTGGAAGTATCCATCCATGTTGAAGTATGCTGAGCTGACCGGCCATTCCTCTAGAGCCCTTTACATGGCTGATAGTCCCGACGGTTGCACGG
TAGCATCAGCCACAGGAGATGAAACATTGAAGTTTTGGAATGTGTTAGGTGATCCTAAAAGTGTGCCTAAAAATTCTGAACCGGAGCCATTCTCTTGGGC
TAACCGCATCAGGTAG
AA sequence
>Lus10038263 pacid=23158502 polypeptide=Lus10038263 locus=Lus10038263.g ID=Lus10038263.BGIv1.0 annot-version=v1.0
MTLWKYPSMLKYAELTGHSSRALYMADSPDGCTVASATGDETLKFWNVLGDPKSVPKNSEPEPFSWANRIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10038263
[exp]
0 1

Lus10038263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.