Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33260 214 / 8e-68 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT4G33270 214 / 1e-67 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT5G27570 195 / 5e-61 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT5G27080 187 / 4e-57 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT5G26900 186 / 5e-57 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G27945 151 / 1e-43 Transducin/WD40 repeat-like superfamily protein (.1) AT4G22910 109 / 6e-28 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) AT5G13840 109 / 7e-28 FZR3 FIZZY-related 3 (.1.2) AT4G11920 103 / 7e-26 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT5G13480 56 / 4e-09 FY Transducin/WD40 repeat-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006851 [exp] 227 / 5e-73 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 224 / 7e-72 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042765 [exp] 221 / 2e-71 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 227 / 1e-69 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042748 [exp] 223 / 4e-68 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10034687 [exp] 214 / 7e-68 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10040282 [exp] 108 / 3e-27 AT5G13840 685 / 0.0 FIZZY-related 3 (.1.2) Lus10024482 [exp] 104 / 4e-26 AT4G22910 733 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Lus10001192 [exp] 104 / 4e-26 AT4G22910 734 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G048900 [exp] 224 / 7e-72 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 224 / 9e-72 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G118400 [exp] 211 / 1e-66 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 206 / 8e-65 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.015G110300 [exp] 116 / 2e-30 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.001G112700 [exp] 110 / 2e-28 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.003G119500 [exp] 108 / 2e-27 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.008G057500 [exp] 105 / 2e-26 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.010G202100 [exp] 102 / 2e-25 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.009G058000 [exp] 50 / 2e-07 AT5G52820 811 / 0.0 WD-40 repeat family protein / notchless protein, putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10038264 pacid=23158174 polypeptide=Lus10038264 locus=Lus10038264.g ID=Lus10038264.BGIv1.0 annot-version=v1.0 ATGAGTTCAAGAACAAGCCATCCTGCTCCAGTCGAGTTGATCCCACATCAACATACTTGTTCTTCTCCACATCGCCATCCTAAACCTGCCAAGCCTCGAC GCCACATTCCTAAGAGTCCAGTGTGGACAGCGGAAGCTACTTCCATTTGTGATGATGTCTCCTTGAACTTACTGGACTGGGGCTCAAACAATATTATAGC AATAGCGCTAGGATTTACCGTAGGGCTATATTATGTTTCAGATCGCACATCTTATGAGCTTGTCACTGTTGATGAGGAAAGTGGCCCTGTTACCAGCGTT AGTTGGGCTCCCGATGGCCGAAGGATTGCCATTGGTTTGGCTAACTCTGAAGTCCAAATGTGGGATTCTGTTGCTGATAAACAGTTATGTACTTTGAGTT GTGGACACAGAGGCTTTGTGGGATCATTGGCATGGAACAACAACATGCTGACAACTGGAGGACTGGATGGTCGGATCATCAATACTGATACCAGGATCCC GGAGCACATAGTCCAAACTTACAGATGCCACAAGAAGGAAGTCTGTAGTCTCAAATGGTCAGATTCAGGGGAACAACTGGCAAGTGGAGGCACTGGCAAC CTCCTTTAG
AA sequence Show only first row Show all	>Lus10038264 pacid=23158174 polypeptide=Lus10038264 locus=Lus10038264.g ID=Lus10038264.BGIv1.0 annot-version=v1.0 MSSRTSHPAPVELIPHQHTCSSPHRHPKPAKPRRHIPKSPVWTAEATSICDDVSLNLLDWGSNNIIAIALGFTVGLYYVSDRTSYELVTVDEESGPVTSV SWAPDGRRIAIGLANSEVQMWDSVADKQLCTLSCGHRGFVGSLAWNNNMLTTGGLDGRIINTDTRIPEHIVQTYRCHKKEVCSLKWSDSGEQLASGGTGN LL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10038264 [exp]	0	1
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10001431 [exp]	2.4	1.0000
					Lus10003840 [exp]	3.5	1.0000
					Lus10005396 [exp]	4.2	1.0000
					Lus10022573 [exp]	4.9	1.0000
					Lus10006661 [exp]	5.5	1.0000
AT5G67210		IRX15-L	IRX15-LIKE, Protein of unknown...		Lus10009378 [exp]	6.0	1.0000
AT1G73750			Uncharacterised conserved prot...		Lus10007966 [exp]	8.4	0.9951
					Lus10012429 [exp]	8.8	1.0000
AT5G14400		CYP724A1	"cytochrome P450, family 724, ...		Lus10003650 [exp]	8.9	1.0000
					Lus10000784 [exp]	9.5	1.0000

Compare expression of checked genes

Lus10038264 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.