Lus10038282 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21360 355 / 1e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025819 470 / 4e-169 AT3G21360 428 / 2e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10038283 350 / 6e-122 AT3G21360 494 / 1e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10025818 350 / 2e-121 AT3G21360 496 / 6e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10037585 295 / 4e-100 AT3G21360 454 / 2e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006839 283 / 3e-95 AT3G21360 435 / 3e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006838 280 / 3e-94 AT3G21360 397 / 5e-139 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006835 265 / 3e-88 AT3G21360 375 / 4e-130 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10017883 171 / 2e-51 AT3G21360 247 / 2e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10035053 170 / 2e-51 AT3G21360 246 / 4e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G190100 357 / 1e-124 AT3G21360 501 / 5e-180 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G131200 195 / 3e-61 AT3G21360 250 / 2e-81 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G131300 189 / 1e-58 AT3G21360 241 / 3e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family
Representative CDS sequence
>Lus10038282 pacid=23158219 polypeptide=Lus10038282 locus=Lus10038282.g ID=Lus10038282.BGIv1.0 annot-version=v1.0
ATGTCGTCGAAGCTTTCTGACTTCGAGGAGCTTCCTTACATCGGCGGGGCGGCTCCACGAAACATCGTCGTTGGCCGCGTGTTCACGGCGAACGACGCTC
CGTCCGAGCACAAGATCACCTTCCACCATGAGATGTCCCAGCTGCCTGTCTACCCGACAAAGCTCTTCTTCTTCTGCGAGGTGGAGCCGGGAAGCCGGGG
AGAGACCCCTTTGGTTCTCAGCCATGTAGTGTACGAGAGGATGAAGGACAAGTACCCCGAATTCGTGGAGAAGCTGGAAGAGCACGGTCTGATATACACG
AGGATTGTCGGGGACGAAGATGATCCTTCGTCGACAATCGGTCGAGGGTGGAAATCAACCTTTTTAACGGACGACAAGGGGGTGGCGGAGGAAAGAGCAG
AAAAGCTGGGGACGAGGTTGGAGTGGACGGAGGATGGAGGAGCGAAGACGGTGATGGGACCCATGGCTGGAGTGAAGGTAATTGAAGAAGAAGGGGAGAA
GAAGAAGAAGAAGAAGACTTGGTTTAACATGTTGGTGGATGCTTACTTGTATTGGGATGACGCGAGAAATGATCGGCGGAAGGCGGTTACTTTCGGGGAT
GGAGGGATTTTGCCAGAGGAGGTGGTGAGAGATTGCGAGAGGATATTGGAAGAGGAGAGCGTTGCTATTCCATGGAAGAAAGGTGATGTTTTGTTGTTGG
ATAATAGGGCAGTGCTTCATGCTCGTAATCCCTTTGATCCCCCCAGAACGATTCTTGCTTCCCTCTGCAAGTAG
AA sequence
>Lus10038282 pacid=23158219 polypeptide=Lus10038282 locus=Lus10038282.g ID=Lus10038282.BGIv1.0 annot-version=v1.0
MSSKLSDFEELPYIGGAAPRNIVVGRVFTANDAPSEHKITFHHEMSQLPVYPTKLFFFCEVEPGSRGETPLVLSHVVYERMKDKYPEFVEKLEEHGLIYT
RIVGDEDDPSSTIGRGWKSTFLTDDKGVAEERAEKLGTRLEWTEDGGAKTVMGPMAGVKVIEEEGEKKKKKKTWFNMLVDAYLYWDDARNDRRKAVTFGD
GGILPEEVVRDCERILEEESVAIPWKKGDVLLLDNRAVLHARNPFDPPRTILASLCK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Lus10038282 0 1
AT3G23150 ETR2 ethylene response 2, Signal tr... Lus10021880 1.4 0.9248
AT3G23150 ETR2 ethylene response 2, Signal tr... Lus10041159 2.0 0.9234
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Lus10030484 2.8 0.9103
AT2G38870 Serine protease inhibitor, pot... Lus10014740 3.0 0.9195
AT2G40940 ERS1 ethylene response sensor 1 (.1... Lus10010310 4.5 0.8919
AT4G24570 DIC2 dicarboxylate carrier 2 (.1) Lus10035936 5.3 0.8748
AT4G19460 UDP-Glycosyltransferase superf... Lus10033297 6.6 0.8623
AT1G27040 Major facilitator superfamily ... Lus10002793 7.3 0.8905
AT2G39980 HXXXD-type acyl-transferase fa... Lus10040222 7.5 0.8393
AT2G39980 HXXXD-type acyl-transferase fa... Lus10028267 8.3 0.8071

Lus10038282 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.