Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025812 [exp] 63 / 2e-14 AT1G66590 142 / 2e-45 A. THALIANA CYTOCHROME C OXIDASE 19-1, cytochrome c oxidase 19-1 (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038288 pacid=23158406 polypeptide=Lus10038288 locus=Lus10038288.g ID=Lus10038288.BGIv1.0 annot-version=v1.0 ATGGCTACAACAGCAACGATGACAACAGAGGTTGCGTATCTCTCACTCGCGGATCAGCCAGAGGAGCTGTTCTCACCGGTGGGGCTCGTCAAAGCCCACC GCTACAAGATTACGTGTGGTGGCCACTTTTCTCACCAAATCAATCCAGATAGGAACTTGATGGCAAAGCAGGAGATGTCTGAACTTGGGTTCGCGGCAAA AGAAAATGACAAGGAAGCTTCTTCAGAAGAAAATGATAAGCAGCGTCTGAATGGCAAGTAA
AA sequence Show only first row Show all	>Lus10038288 pacid=23158406 polypeptide=Lus10038288 locus=Lus10038288.g ID=Lus10038288.BGIv1.0 annot-version=v1.0 MATTATMTTEVAYLSLADQPEELFSPVGLVKAHRYKITCGGHFSHQINPDRNLMAKQEMSELGFAAKENDKEASSEENDKQRLNGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038288 [exp]	0	1
AT5G26770			unknown protein		Lus10001515 [exp]	14.2	0.8866
AT2G42710			Ribosomal protein L1p/L10e fam...		Lus10004691 [exp]	28.1	0.8766
AT5G27730			Protein of unknown function (D...		Lus10022615 [exp]	33.6	0.8771
					Lus10012304 [exp]	51.8	0.8719
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10035196 [exp]	58.1	0.8670
AT5G11010			Pre-mRNA cleavage complex II p...		Lus10033124 [exp]	84.9	0.8516
AT5G66040		STR16	sulfurtransferase protein 16 (...		Lus10012566 [exp]	106.7	0.8480
AT4G35783		RTFL6, DVL17	DEVIL 17, ROTUNDIFOLIA like 6 ...		Lus10041846 [exp]	109.5	0.8244
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10037262 [exp]	132.9	0.8443
AT1G44910		ATPRP40A	pre-mRNA-processing protein 40...		Lus10033770 [exp]	163.3	0.8433

Compare expression of checked genes

Lus10038288 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.