Lus10038298 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42510 105 / 9e-29 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 103 / 5e-28 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 98 / 8e-26 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 98 / 8e-26 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 86 / 3e-21 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21110 84 / 1e-20 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G58090 86 / 3e-20 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G38700 76 / 2e-17 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 75 / 4e-17 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 74 / 1e-16 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025804 327 / 6e-116 AT1G22900 116 / 7e-33 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021083 102 / 3e-27 AT1G22900 150 / 5e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10016231 100 / 2e-26 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021084 99 / 5e-26 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029312 89 / 1e-22 AT3G13660 135 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029306 88 / 6e-22 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10018340 87 / 1e-21 AT1G58170 129 / 3e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 84 / 2e-20 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 82 / 2e-19 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G061400 96 / 7e-25 AT2G21110 223 / 7e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G131000 94 / 2e-24 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 89 / 2e-22 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 86 / 4e-21 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.016G060700 85 / 7e-21 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 84 / 2e-20 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 84 / 3e-20 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 81 / 3e-19 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G130900 80 / 5e-19 AT2G21110 185 / 5e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 80 / 6e-19 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10038298 pacid=23158281 polypeptide=Lus10038298 locus=Lus10038298.g ID=Lus10038298.BGIv1.0 annot-version=v1.0
ATGGCTTCCAATCTCTTCCTCTCCATCCTGACGCTATCCGTTCTTTACATCGCCTACACTATCCCAAGACACGACCATCACCAACCAAAGTCAACCAACC
TTGTCGTCTACGTCCACGACAAGTTCACCGGTGCCGACGCAACTGCAGTGACGGTCGCCGGGAAGCAGGATGAGCCCACATCAGCCTTCAATATCCTGCG
GTTCGGGTCCGTGGCCGTAGTGGACGATCCAGTCACGGATGGCCCCACAAAGGAGTCGAATGAAATCGGCAGGGCCCAGGGAGCATACATAAATTCGCAG
ATGGACGGGAAGGGGCTGTATTTGGTATTCTCCATCATTTTCACCGGCGGGGAATATAAAGGGAGCACGGTGGAGATGCAAGGGTCGGATATTTTCTCGA
TGAAAGAGAGGGAGTTTGGGGTGGTTTCGGGTACGGGTTATTTCAGATTTGTGAAAGGGTATGGGATCATGGAGACGGCGTTCATGGATGTTGCTAATCT
TAGCGCCATTATTAAGCTTAATGTCACTGTTAAACATTACTAA
AA sequence
>Lus10038298 pacid=23158281 polypeptide=Lus10038298 locus=Lus10038298.g ID=Lus10038298.BGIv1.0 annot-version=v1.0
MASNLFLSILTLSVLYIAYTIPRHDHHQPKSTNLVVYVHDKFTGADATAVTVAGKQDEPTSAFNILRFGSVAVVDDPVTDGPTKESNEIGRAQGAYINSQ
MDGKGLYLVFSIIFTGGEYKGSTVEMQGSDIFSMKEREFGVVSGTGYFRFVKGYGIMETAFMDVANLSAIIKLNVTVKHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42510 Disease resistance-responsive ... Lus10038298 0 1
AT4G31130 Protein of unknown function (D... Lus10030037 5.3 0.8203
AT5G63030 GRXC1 glutaredoxin C1, Thioredoxin s... Lus10042104 7.1 0.8702
AT3G23360 Protein phosphatase 2C family ... Lus10021171 10.8 0.8379
AT1G67110 CYP735A2 "cytochrome P450, family 735, ... Lus10006246 12.0 0.8407
Lus10034710 12.9 0.8426
AT2G26710 CYP72B1, CYP734... PHYB ACTIVATION TAGGED SUPPRES... Lus10006245 27.5 0.8110
AT2G38310 RCAR10, PYL4 regulatory components of ABA r... Lus10022675 28.1 0.8174
AT5G28010 Polyketide cyclase/dehydrase a... Lus10008930 42.3 0.8094
AT1G68090 ANN5, ANNAT5 ANNEXIN ARABIDOPSIS THALIANA 5... Lus10009225 46.0 0.8103
AT5G61310 Cytochrome c oxidase subunit V... Lus10010008 59.9 0.7947

Lus10038298 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.